Citrus Sinensis ID: 020302

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MVDYEWGNPSTILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTLYHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHSMLSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEAGSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQQPTTTPLQDNQKSQLEPEILAKSPPDSGAHSSSSVTVAVSPPRMSLDCFRQKPSQATASTSAGSLFFSSG
cccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHHHHccHHHHcccccccccccccEEEEcccEEEEHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MVDYE**NP*********************DHYTTQEPFSQHSTNNNNYFHQPITNTTLYH*********************************LFDPRA**************LSIDAASGGYFMIPKTE*******NFASRIGLNLGGRTYFSS*************************CQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEF*********************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVDYEWGNPSTILLTGDEATQEPNQSRQIFDHYTTQEPFSQHSTNNNNYFHQPITNTTLYHHHHQQQQPPPPPPPPHHHHHHNNNNNNSNNAHSLFDPRAYTSASSYAPTHHSMLSIDAASGGYFMIPKTEEVSRPVDNFASRIGLNLGGRTYFSSADDDFVSRLYRRPRPGEAGSANIPRCQAEGCSADLTHAKHYHRRHKVCEFHSKASTVIAAGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQQQPTTTPLQDNQKSQLEPEILAKSPPDSGAHSSSSVTVAVSPPRMSLDCFRQKPSQATASTSAGSLFFSSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Squamosa promoter-binding-like protein 8 Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower.probableQ8GXL3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UL4, chain A
Confidence level:very confident
Coverage over the Query: 179-259
View the alignment between query and template
View the model in PyMOL