Citrus Sinensis ID: 020326


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MSGAAAAGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTGHLLALDGASERLQLFKANLLEEGSYDSVVDGCDGVFHTASPFYHDVKDPQVELLDPAVKGTVNVLNSCAKFPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSKLWYVLSKTLAEDAAWKFAKEKSIDMVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYPNATLGWVNVKDVANAHIQAFEVPSASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCADDKPYVPTYQVSKEKAKNLGIEFIPLEVSLKETIESLKEKGFVDF
cccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHcccccccEEEEEccccccccHHHHHccccCEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccEEEcccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHcccccccccccccEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccEEccHHHHHHccccECcHHHHHHHHHHHHHHcccccc
*******GKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTGHLLALDGASERLQLFKANLLEEGSYDSVVDGCDGVFHTASPFYHDVKDPQVELLDPAVKGTVNVLNSCAKFPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSKLWYVLSKTLAEDAAWKFAKEKSIDMVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYPNATLGWVNVKDVANAHIQAFEVPSASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCADDKPYVPTYQVSKEKAKNLGIEFIPLEVSLKETIESLKEKGFVDF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGAAAAGKVVCVTGASGYIASWLVKLLLSRGYTVKASVRDPNDPKKTGHLLALDGASERLQLFKANLLEEGSYDSVVDGCDGVFHTASPFYHDVKDPQVELLDPAVKGTVNVLNSCAKFPSIKRVVLTSSMAAVAYNGKPRTPDVVVDETWFSDPEVCKQSKLWYVLSKTLAEDAAWKFAKEKSIDMVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAQTYPNATLGWVNVKDVANAHIQAFEVPSASGRYCLVERVLHYSKLVNTVHELYPTFELPEKCADDKPYVPTYQVSKEKAKNLGIEFIPLEVSLKETIESLKEKGFVDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADPH-dependent aldehyde reductase ARI1 NADPH-dependent aldehyde reductase involved in the detoxification of aldehyde inhibitors derived from lignocellulosic biomass conversion. Reduces commonly detected inhibitors in biomass conversion hydrolysates such as furfural, 5-hydroxymethylfurfural (HMF), cinnamic aldehyde, benzaldehyde, phenylacetaldehyde, and anisaldehyde.probableP53111

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RH8, chain A
Confidence level:very confident
Coverage over the Query: 8-325
View the alignment between query and template
View the model in PyMOL