Citrus Sinensis ID: 020330

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------

MSQSSAAKTKGRSVVEDKLYPAPLSSHEDVSKDPIVFWDTLRRFHFIMGTKFMIPVIGGKELDLHVLYVEATTRGGYEKVVAEKKWREVGAVFKFSPTTTSASFVLRKHYLTLLYHYEQVHFFKMQGPPCVPSASFSVHSPSCRPGLALVEYSPKRINDHPDSHIEGQSCFTAVGRIDGKFDCGYLVSVKLGSETLSGVLYHPDHPGPSTSFCQSNDVGAIIPYTPNSKRRYGRRRRSKRRGDPSYPKPNRSGYNFFFAEKHYKLKSLYPNREREFTKMIGESWTNLSPEERKVYQNIGLKDKERYNRELKEYKERLKLRQGEGANS

cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHHcccHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

*******************************KDPIVFWDTLRRFHFIMGTKFMIPVIGGKELDLHVLYVEATTRGGYEKVVAEKKWREVGAVFKFSPTTTSASFVLRKHYLTLLYHYEQVHFFK********************************************SCFTAVGRIDGKFDCGYLVSVKLGSETLSGVLYHP*************************************************GYNFFFAEKHYKLKSLYPNREREFTKMIGESWTN********Y***GLKDKERYNR*******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
High mobility group B protein 9	Binds preferentially DNA with A/T-rich content.	probable	Q9SGS2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IG6, chain A
Confidence level:very confident
Coverage over the Query: 32-133
View the alignment between query and template
View the model in PyMOL

Template: 2YRQ, chain A
Confidence level:very confident
Coverage over the Query: 217-316
View the alignment between query and template
View the model in PyMOL