Citrus Sinensis ID: 020332


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPIPLRDVNKPPRKREANNEESEDSDDEWEEVGPDEVLVSEATNSLTNLNVGSPADDDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
cccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccccHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccEEccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccc
ccccEEccEEEEEccHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcHHHHccccccccccccccccccHHHHHHHcccccccccccccEEEcccccccHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mpgltcnscnrefnddaeqklhyksdwhrynlkrkvagvpgvTEALFLARQAALAQEknknatpmtyscglcgkgyrsSKALAQHLNSRShimrasqgtsneekekviikpiplrdvnkpprkreanneesedsddeweevgpdevLVSEATnsltnlnvgspadddleeddddgafeefdpaccfmcdlphdaiENCMVHMhkchgffipdveylkdpkglLTYLGLKvkrdfmclycndrchpfnsLEAVRKHMEAKRhckihfgdgddeeEAELEEFydyssrslsSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
MPGLTCNSCNREFNDDAEQKlhyksdwhrynLKRKVAGVPGVTEALFLARQAALAqeknknatpmTYSCGLCGKGYRSSKALAQHLNSRSHImrasqgtsneekekviikpiplrdvnkpprkreanneesedsddeweeVGPDEVLVSeatnsltnlnvgspaddDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEalflarqaalaqEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPIPLRDVNKPPRKREANNeesedsddeweeVGPDEVLVSEATNSLTNLNVGSPadddleeddddgafeefdPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHfgdgddeeeaeleefydySSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
*******************KLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQ*****ATPMTYSCGLCGKGY******************************************************************************************************EFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFG*********LEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMR****
*PGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSC****************************************************************************************LNVGSPADDDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLS***************YLLFNKIIKFFVLTVTWMRMG**
MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHI************EKVIIKPIPLRDVNK**********************GPDEVLVSEATNSLTNLNVGSPADDDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
*PGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSN****************************************************************************EEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPIPLRDVNKPPRKREANNEESEDSDDEWEEVGPDEVLVSEATNSLTNLNVGSPADDDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSLSSKFIFLFCFLFPNLIYLLFNKIIKFFVLTVTWMRMGNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q91VY9476 Zinc finger protein 622 O yes no 0.853 0.586 0.311 7e-34
O59811 463 Zinc finger protein C550. yes no 0.819 0.578 0.287 6e-30
Q7TM96386 Zinc finger protein 622 O no no 0.299 0.253 0.465 2e-18
Q06709 432 Zinc finger protein REH1 yes no 0.816 0.618 0.274 3e-18
Q969S3477 Zinc finger protein 622 O yes no 0.299 0.205 0.465 3e-18
Q90Y35405 Zinc finger protein 622 O yes no 0.299 0.241 0.435 3e-17
P38344393 Pre-60S factor REI1 OS=Sa no no 0.131 0.109 0.558 3e-07
Q9H8Y5 726 Ankyrin repeat and zinc f no no 0.113 0.050 0.459 0.0003
Q66H85 722 Ankyrin repeat and zinc f no no 0.134 0.060 0.409 0.0003
Q80UU1 748 Ankyrin repeat and zinc f no no 0.134 0.058 0.409 0.0004
>sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=2 SV=1 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 149/356 (41%), Gaps = 77/356 (21%)

Query: 1   MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLAR---QAALAQE 57
           M  LTC +C   F D   Q+ HYK+DWHRYNL+RKVA +  VT   F  R   Q A+A+ 
Sbjct: 1   MAALTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEA 60

Query: 58  KNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSH-------------------------- 91
              +    TY C  CGK + +  A   HL SR H                          
Sbjct: 61  AEASKGAATY-CTACGKKFATFNAYENHLGSRRHAELERKAVRAASRRVELLNAKNLEKG 119

Query: 92  --------------IMRASQGTSNEEKEKVIIKP-------------IPLRD-VNKPPRK 123
                         I +A +   +   +K    P             +P RD   KPPR 
Sbjct: 120 LGADGVDKDAVNAAIQQAIKAQPSTSPKKAPFVPTDECGRAAAGARGVPERDPTEKPPRL 179

Query: 124 REANNEESEDSDDEWEEVGPDEVLVSEATNSLT--------NLNVGSPADDDLEEDDDDG 175
           +    +  + +  +WE+   +     E               L    P  +D  +D +D 
Sbjct: 180 QWFEQQAKKLAKQQWEDGEEEGEEEEEDDEDEDWEDIDSDDGLECEDPGVED--QDAEDA 237

Query: 176 AFEEFDPAC------CFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLK 229
           A EE  P        C  C     ++   + HM K H FFIPD+EYL D KGL+ YLG K
Sbjct: 238 AAEESPPLGAIPITDCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEK 297

Query: 230 VKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSS 285
           V    +CL+CN++   F S EAV+ HM  K HCK+ F DGD     E  +FYD+ S
Sbjct: 298 VGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKL-FTDGD--AALEFADFYDFRS 350




May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
Mus musculus (taxid: 10090)
>sp|O59811|YJVF_SCHPO Zinc finger protein C550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 Back     alignment and function description
>sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=2 SV=2 Back     alignment and function description
>sp|Q06709|REH1_YEAST Zinc finger protein REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 Back     alignment and function description
>sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 Back     alignment and function description
>sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 Back     alignment and function description
>sp|P38344|REI1_YEAST Pre-60S factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 Back     alignment and function description
>sp|Q9H8Y5|ANKZ1_HUMAN Ankyrin repeat and zinc finger domain-containing protein 1 OS=Homo sapiens GN=ANKZF1 PE=1 SV=1 Back     alignment and function description
>sp|Q66H85|ANKZ1_RAT Ankyrin repeat and zinc finger domain-containing protein 1 OS=Rattus norvegicus GN=Ankzf1 PE=2 SV=1 Back     alignment and function description
>sp|Q80UU1|ANKZ1_MOUSE Ankyrin repeat and zinc finger domain-containing protein 1 OS=Mus musculus GN=Ankzf1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
356563786407 PREDICTED: zinc finger protein 622-like 0.859 0.690 0.742 1e-110
225429787411 PREDICTED: zinc finger protein 622 [Viti 0.862 0.686 0.711 1e-108
255574095407 transcription factor, putative [Ricinus 0.859 0.690 0.737 1e-108
356539178407 PREDICTED: zinc finger protein 622-like 0.859 0.690 0.742 1e-108
356563788407 PREDICTED: zinc finger protein 622-like 0.859 0.690 0.735 1e-107
388507466410 unknown [Lotus japonicus] 0.868 0.692 0.724 1e-107
388508652410 unknown [Lotus japonicus] 0.868 0.692 0.724 1e-107
302398699405 C2H2L domain class transcription factor 0.850 0.686 0.758 1e-106
224121192408 predicted protein [Populus trichocarpa] 0.865 0.693 0.740 1e-104
296081767376 unnamed protein product [Vitis vinifera] 0.758 0.659 0.651 1e-101
>gi|356563786|ref|XP_003550140.1| PREDICTED: zinc finger protein 622-like [Glycine max] Back     alignment and taxonomy information
 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 213/287 (74%), Positives = 243/287 (84%), Gaps = 6/287 (2%)

Query: 1   MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK 60
           MPGLTCN+CN EF DD EQKLHYKS+WHRYNLKRKVAGVPGVTEALFLARQ+ LAQEKNK
Sbjct: 1   MPGLTCNACNTEFKDDTEQKLHYKSEWHRYNLKRKVAGVPGVTEALFLARQSVLAQEKNK 60

Query: 61  -NATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPIPLRDVNK 119
              TPM Y+CGLCGK Y+SSKA A+HL SR H+MRAS+GTS+ + EK I+KP+P R VN+
Sbjct: 61  LGETPMLYTCGLCGKDYKSSKAHAEHLKSRGHMMRASEGTSHAD-EKAIVKPLPQRVVNR 119

Query: 120 PPRKREANNEESEDSDDEWEEVGPDEVLVSEATNSLTNLNVGSPADD-DLEEDDDDGAFE 178
           PP +RE +N E+E+S+DEWEEV P+E LV  A  SLT+LNV    ++ D+E DDD   FE
Sbjct: 120 PPPRREVDNSENEESEDEWEEVDPEEDLVDGAAKSLTDLNVNEHGENVDMEVDDD---FE 176

Query: 179 EFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLY 238
           E DP+CCFMCD  H  IENCMVHMHK HGFFIPDVEYLKDPKGLLTYLGLKVKRD+MCLY
Sbjct: 177 ELDPSCCFMCDQEHKTIENCMVHMHKHHGFFIPDVEYLKDPKGLLTYLGLKVKRDYMCLY 236

Query: 239 CNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSS 285
           CNDRC+PF+SLEAVRKHMEAK HCK+H+GDG D+EE ELEEFYDYSS
Sbjct: 237 CNDRCYPFSSLEAVRKHMEAKSHCKVHYGDGVDDEEVELEEFYDYSS 283




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225429787|ref|XP_002282746.1| PREDICTED: zinc finger protein 622 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574095|ref|XP_002527963.1| transcription factor, putative [Ricinus communis] gi|223532589|gb|EEF34375.1| transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356539178|ref|XP_003538077.1| PREDICTED: zinc finger protein 622-like [Glycine max] Back     alignment and taxonomy information
>gi|356563788|ref|XP_003550141.1| PREDICTED: zinc finger protein 622-like [Glycine max] Back     alignment and taxonomy information
>gi|388507466|gb|AFK41799.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388508652|gb|AFK42392.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|302398699|gb|ADL36644.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|224121192|ref|XP_002330766.1| predicted protein [Populus trichocarpa] gi|222872568|gb|EEF09699.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296081767|emb|CBI20772.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
TAIR|locus:2128161405 AT4G31420 [Arabidopsis thalian 0.785 0.634 0.563 4.8e-78
TAIR|locus:2061087395 FZF [Arabidopsis thaliana (tax 0.256 0.212 0.809 1.1e-76
UNIPROTKB|F1N194470 ZNF622 "Uncharacterized protei 0.244 0.170 0.487 2e-33
FB|FBgn0030878409 CG6769 [Drosophila melanogaste 0.244 0.195 0.530 1.7e-32
RGD|1309146386 Zfp622 "zinc finger protein 62 0.244 0.207 0.475 1.9e-32
UNIPROTKB|F1LQ57475 Fam134b "Protein FAM134B" [Rat 0.244 0.168 0.475 6.3e-32
MGI|MGI:1289282476 Zfp622 "zinc finger protein 62 0.244 0.168 0.475 1e-31
UNIPROTKB|E2R1D3458 ZNF622 "Uncharacterized protei 0.244 0.174 0.475 1.1e-31
UNIPROTKB|F1M7M5745 Fam134b "Protein FAM134B" [Rat 0.244 0.107 0.475 3.5e-31
UNIPROTKB|Q969S3477 ZNF622 "Zinc finger protein 62 0.244 0.167 0.475 5.8e-31
TAIR|locus:2128161 AT4G31420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 785 (281.4 bits), Expect = 4.8e-78, P = 4.8e-78
 Identities = 151/268 (56%), Positives = 176/268 (65%)

Query:     1 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEXXXXXXXXXXXXEKNK 60
             MPGLTCN+CN EF D+ E+ LHYKSDWHRYNLKRKVAGVPGVTE            EKNK
Sbjct:     1 MPGLTCNACNMEFKDEEERNLHYKSDWHRYNLKRKVAGVPGVTEALFEARQSALAQEKNK 60

Query:    61 -NATPMTYSCGLCGKGYRSSKALAQHLNSRSHIMRASQGTS-NEEKEKVIIKPIPLRDVN 118
              N  PM Y+C +C KGYRSSKA  QHL SRSH++R SQGTS N E++  II+ +P     
Sbjct:    61 SNEAPMLYTCAICAKGYRSSKAHEQHLQSRSHVLRVSQGTSINGEEDIAIIRQLP----- 115

Query:   119 KPPRKREANNXXXXXXXXXXXXVGPDEVLVSE-ATNSLTNLNVGSPXXXXXXXXXXXXXX 177
                R+ +               V  DE L +E A++SL+ LNV                 
Sbjct:   116 ---RRVQHRGSIDDDSEDEWVEVDSDEELAAEEASDSLSKLNVNESGSAEDMDDDGDADK 172

Query:   178 XXXXPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCL 237
                 P CC MCD  H  +E+CM+HMHK HGFFIPD+EYLKDP+GLLTYLGLKVKRDFMCL
Sbjct:   173 YELDPTCCLMCDKKHKTLESCMLHMHKHHGFFIPDIEYLKDPEGLLTYLGLKVKRDFMCL 232

Query:   238 YCNDRCHPFNSLEAVRKHMEAKRHCKIH 265
             YCN+ C PF+SLEAVRKHMEAK HCK+H
Sbjct:   233 YCNELCRPFSSLEAVRKHMEAKSHCKLH 260




GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2061087 FZF [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N194 ZNF622 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0030878 CG6769 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1309146 Zfp622 "zinc finger protein 622" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ57 Fam134b "Protein FAM134B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1289282 Zfp622 "zinc finger protein 622" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1D3 ZNF622 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M7M5 Fam134b "Protein FAM134B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q969S3 ZNF622 "Zinc finger protein 622" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
pfam12756100 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 cop 2e-36
PTZ00448373 PTZ00448, PTZ00448, hypothetical protein; Provisio 0.002
>gnl|CDD|221755 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 copies) Back     alignment and domain information
 Score =  126 bits (318), Expect = 2e-36
 Identities = 49/102 (48%), Positives = 63/102 (61%), Gaps = 5/102 (4%)

Query: 184 CCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRC 243
            C  C+   D +E  + HM K HGFFIP+ EYL D +GLL YL  K+     CLYC  + 
Sbjct: 1   DCLFCNHTSDTVEENLEHMFKSHGFFIPEREYLVDLEGLLNYLREKIHEGNECLYCGKQ- 59

Query: 244 HPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSS 285
             F SLEA+R+HM  K HCKI +    +EE+ E+ EFYD+SS
Sbjct: 60  --FKSLEALRQHMRDKGHCKIPY--ETEEEKDEIAEFYDFSS 97


This family contains two copies of a C2H2-like zinc finger domain. Length = 100

>gnl|CDD|185627 PTZ00448, PTZ00448, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 100.0
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 99.73
KOG2482423 consensus Predicted C2H2-type Zn-finger protein [T 99.63
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.46
PTZ00448373 hypothetical protein; Provisional 99.46
KOG2482 423 consensus Predicted C2H2-type Zn-finger protein [T 99.27
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.24
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.13
KOG3608467 consensus Zn finger proteins [General function pre 99.0
KOG3576267 consensus Ovo and related transcription factors [T 98.79
KOG1074958 consensus Transcriptional repressor SALM [Transcri 98.74
KOG2505 591 consensus Ankyrin repeat protein [General function 98.59
KOG3608467 consensus Zn finger proteins [General function pre 98.55
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 98.41
KOG3576267 consensus Ovo and related transcription factors [T 98.36
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.36
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.34
PHA00733128 hypothetical protein 98.11
PHA0276855 hypothetical protein; Provisional 98.06
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.91
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.86
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.8
PHA00733128 hypothetical protein 97.78
PHA0073279 hypothetical protein 97.73
PHA0276855 hypothetical protein; Provisional 97.62
KOG3993500 consensus Transcription factor (contains Zn finger 97.56
PHA0073279 hypothetical protein 97.52
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 97.48
PLN03086567 PRLI-interacting factor K; Provisional 97.38
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 97.24
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.2
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.96
PHA0061644 hypothetical protein 96.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.8
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.68
PHA0061644 hypothetical protein 96.65
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.62
KOG3993500 consensus Transcription factor (contains Zn finger 96.59
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.56
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.46
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.46
COG5189423 SFP1 Putative transcriptional repressor regulating 96.31
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.21
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 95.96
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 95.88
KOG1146 1406 consensus Homeobox protein [General function predi 95.78
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.77
smart0035526 ZnF_C2H2 zinc finger. 95.43
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 95.43
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.66
PLN03086567 PRLI-interacting factor K; Provisional 93.18
KOG2785390 consensus C2H2-type Zn-finger protein [General fun 92.66
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.64
smart0035526 ZnF_C2H2 zinc finger. 92.36
KOG3408129 consensus U1-like Zn-finger-containing protein, pr 92.26
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 91.48
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 91.46
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 90.24
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 89.3
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 88.75
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 88.71
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.18
COG5188470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 88.18
PLN02748468 tRNA dimethylallyltransferase 87.62
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 87.44
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 87.31
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 87.14
COG5236 493 Uncharacterized conserved protein, contains RING Z 86.44
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 84.89
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 84.86
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 84.3
KOG2893341 consensus Zn finger protein [General function pred 83.53
COG5189423 SFP1 Putative transcriptional repressor regulating 82.37
PF1382155 DUF4187: Domain of unknown function (DUF4187) 81.0
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 80.87
COG404965 Uncharacterized protein containing archaeal-type C 80.45
KOG11461406 consensus Homeobox protein [General function predi 80.38
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 80.3
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.5e-66  Score=491.01  Aligned_cols=280  Identities=42%  Similarity=0.703  Sum_probs=217.3

Q ss_pred             CCCccccccccccCChHHHhccccccccccchhhhhcCCCCccHHHHHHHHHHHHHHhhh--cCCCCeeecCCcCCcccC
Q 020332            1 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNK--NATPMTYSCGLCGKGYRS   78 (327)
Q Consensus         1 ~~~f~C~~C~~~F~~~~~lr~H~ksdwHryNlKRkva~lppv~~~~F~~k~~~l~~~~~~--h~~~~~~~C~~C~K~F~s   78 (327)
                      |+.|+|++|.+.|.+.+.||.||+|||||||||||||++|||+.+.|+.++.+.+..+..  ..++.++.|.+|+|+|.+
T Consensus         1 st~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s   80 (390)
T KOG2785|consen    1 STGFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFAS   80 (390)
T ss_pred             CCcceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccC
Confidence            788999999999999999999999999999999999999999999999998666554333  346788999999999999


Q ss_pred             hHHHHHHHhhhhhhhhhccCCChhhhhhhhccCCCCcCCCCCCCccccCCCCCCCCccccccCCcchhhhhhhccccccc
Q 020332           79 SKALAQHLNSRSHIMRASQGTSNEEKEKVIIKPIPLRDVNKPPRKREANNEESEDSDDEWEEVGPDEVLVSEATNSLTNL  158 (327)
Q Consensus        79 ~~~l~~Hl~skkHk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~e~~e~~~~~~~~~~~~~~~~~~  158 (327)
                      .+++.+||.||+|+.+.++.....+.+.+.+++++...++    ...    .-.+++..|.|++..+..      + .+.
T Consensus        81 ~~a~~~hl~Sk~h~~~~~~~~r~~e~d~a~~~q~~~~~p~----~l~----~~~e~e~~~~E~~~~~d~------~-~e~  145 (390)
T KOG2785|consen   81 PKAHENHLKSKKHVENLSNHQRSEEGDSAKISQLPSRRPS----NLQ----NKGESELKWYEVDSDEDS------S-EEE  145 (390)
T ss_pred             hhhHHHHHHHhhcchhhhhhhccccccchhhhhccccCcc----ccc----cCCCcccchhhccccccc------c-hhh
Confidence            9999999999999998777554333333344444432211    000    011245566555543100      0 000


Q ss_pred             CCCCCCCCCCccCCCCCCCCCCCCCCCCCCCCCCCChhhhhhhhhhcccCCCCCcccccChHHHHHHhhhhccCCccccc
Q 020332          159 NVGSPADDDLEEDDDDGAFEEFDPACCFMCDLPHDAIENCMVHMHKCHGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLY  238 (327)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~p~~ClfC~~~f~s~~~l~~HM~~~H~f~ip~~~~l~d~~gLl~yl~~ki~~~~~Cl~  238 (327)
                      ...  +..+|+ +++.....+..|..||||++.+++++.++.||..+||||||+.+||+|+.|||.||++||+.++.||+
T Consensus       146 ~~d--d~~Edi-~~d~~~e~e~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~  222 (390)
T KOG2785|consen  146 EED--DEEEDI-EEDGDDEDELIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLF  222 (390)
T ss_pred             ccC--cchhhh-hhccchhcccCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEE
Confidence            000  111111 11111223456699999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCcccCCHHHHHHHHHhcCCcccCCCCCChhHHHhhhhhccccCCCC--CCcceeeccCCCh
Q 020332          239 CNDRCHPFNSLEAVRKHMEAKRHCKIHFGDGDDEEEAELEEFYDYSSRSL--SSKFIFLFCFLFP  301 (327)
Q Consensus       239 C~~~gk~F~s~~~l~~HM~~k~Hcki~~~~~~~e~~~e~~~fYd~~~sy~--~~~~~~~~~~~~~  301 (327)
                      ||..|+.|+|++++|+||++|+||+|+| ++  |+++||++|||||+||+  ++++.+..+++.+
T Consensus       223 CN~~~~~f~sleavr~HM~~K~HCkl~y-d~--ee~~El~efYDfsssY~d~~~~~~~~~~e~~~  284 (390)
T KOG2785|consen  223 CNELGRPFSSLEAVRAHMRDKGHCKLPY-DG--EERLELAEFYDFSSSYPDIAENQDPDSAEEDP  284 (390)
T ss_pred             eccccCcccccHHHHHHHhhccCcccCC-Ch--HHHhhhhhhhcCcccccCcccCCCCcchhcCC
Confidence            9999999999999999999999999999 54  88999999999999998  5666666555555



>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PTZ00448 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13821 DUF4187: Domain of unknown function (DUF4187) Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 5e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-05
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Length = 127 Back     alignment and structure
 Score = 61.1 bits (147), Expect = 5e-12
 Identities = 17/91 (18%), Positives = 35/91 (38%), Gaps = 2/91 (2%)

Query: 4   LTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNAT 63
             C  C+     ++++  HY+S  H   ++R +A   G       A++   A  +  +  
Sbjct: 33  TQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSV--PAKKFKAAPAEISDGE 90

Query: 64  PMTYSCGLCGKGYRSSKALAQHLNSRSHIMR 94
             +  C +C   + S      H   ++HI  
Sbjct: 91  DRSKCCPVCNMTFSSPVVAESHYIGKTHIKN 121


>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.7
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.63
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.59
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.59
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.53
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.5
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.45
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.44
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.37
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.36
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.36
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.32
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.32
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.26
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.23
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.22
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.2
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.18
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.17
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.03
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.01
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.0
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.0
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.0
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.0
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.95
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.95
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.93
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.9
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.9
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.89
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.87
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.84
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.84
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 98.82
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.82
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.79
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.79
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.79
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.78
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.78
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.77
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.77
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.76
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.76
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.74
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.72
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.71
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.7
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.61
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.61
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.6
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.58
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.57
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.56
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.55
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.5
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.43
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.43
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.41
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.38
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.37
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.3
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.29
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.25
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.1
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.07
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.99
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 97.97
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.88
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.87
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.85
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.83
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.82
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.81
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.81
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.81
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.81
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.81
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.8
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.8
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.8
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.79
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.79
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.79
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.79
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.79
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.79
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.79
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.79
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.79
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.78
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.78
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 97.78
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.78
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.78
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.78
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.78
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.78
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.77
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.77
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.77
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.77
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.77
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.77
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.77
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.77
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.77
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 97.77
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.77
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.76
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.76
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.76
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.76
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.76
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.76
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.76
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.76
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 97.76
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.76
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.76
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.76
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.76
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.76
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.76
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.76
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.75
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.75
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.75
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 97.75
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.75
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.75
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.75
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 97.75
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.74
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.74
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.74
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.74
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.74
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.74
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.74
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.74
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.73
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 97.73
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.73
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.73
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.73
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.72
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.72
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.72
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.72
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.72
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.72
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.72
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.72
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.72
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.72
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.72
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 97.72
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.71
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.71
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.71
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.71
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.71
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.71
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.71
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.71
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.7
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.7
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.7
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.7
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.7
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 97.69
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.69
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 97.69
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.69
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.69
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.69
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.69
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.69
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.69
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.69
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.69
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.68
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.68
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.67
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.67
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.67
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.67
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.67
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.67
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.66
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.66
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.66
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.65
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.65
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.65
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.64
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.63
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.63
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.63
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.62
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.6
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.6
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.6
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.59
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.57
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.57
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 97.56
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.55
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.53
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.53
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.53
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.52
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.51
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.51
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.5
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 97.5
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.5
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.49
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.48
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 97.48
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.47
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.47
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.46
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.46
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.45
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.45
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.44
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.43
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.42
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.42
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.41
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.4
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.37
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.36
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.35
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.34
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.34
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.34
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.33
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.32
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.3
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.29
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.29
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.29
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.28
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.27
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.26
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.26
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.25
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.25
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.25
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.25
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.24
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.22
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.22
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.31
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.22
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.21
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.21
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.21
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.2
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.2
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.2
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.2
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.18
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.17
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.16
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.11
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.1
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.09
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.05
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.04
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.02
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.01
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.03
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 96.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.96
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.01
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 96.95
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 95.99
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 96.93
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 96.91
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 96.91
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 96.9
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 96.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.89
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 96.87
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.85
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 96.85
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 96.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 96.84
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.8
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 96.79
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 96.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.78
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.77
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.72
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 96.7
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 96.69
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 96.68
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 95.7
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 96.67
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.67
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 95.69
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.64
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 96.62
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 96.62
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.52
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.52
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 96.52
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.52
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 96.52
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.45
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 96.43
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 96.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.4
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 96.38
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.37
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 96.35
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 96.34
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 96.33
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.28
1paa_A30 Yeast transcription factor ADR1; transcription reg 96.27
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.25
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.24
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 96.23
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.15
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 96.14
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 96.12
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 96.03
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 95.94
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.84
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 95.83
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 95.71
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.58
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.34
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 95.22
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 95.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 94.7
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 94.3
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 93.68
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.37
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.31
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.82
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 90.41
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.57
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.25
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 83.85
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 83.41
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 82.99
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 82.53
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.70  E-value=1.3e-17  Score=145.10  Aligned_cols=77  Identities=19%  Similarity=0.448  Sum_probs=50.3

Q ss_pred             CCccccccccccCChHHHhccccccccccchhhhhcCCCCccHH----HHHHHHHHHHHHhhhcCCCCeeecCCcCCccc
Q 020332            2 PGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEA----LFLARQAALAQEKNKNATPMTYSCGLCGKGYR   77 (327)
Q Consensus         2 ~~f~C~~C~~~F~~~~~lr~H~ksdwHryNlKRkva~lppv~~~----~F~~k~~~l~~~~~~h~~~~~~~C~~C~K~F~   77 (327)
                      .+|.|..|++.|.+...|+.|+++  |.        +..|+.|.    .|..+ ..|..|++.|.++++|.|.+|++.|.
T Consensus        20 ~~~~C~~C~~~f~~~~~l~~H~~~--h~--------~~~~~~C~~C~~~f~~~-~~l~~H~~~h~~~~~~~C~~C~~~f~   88 (190)
T 2i13_A           20 KPYACPECGKSFSRSDHLAEHQRT--HT--------GEKPYKCPECGKSFSDK-KDLTRHQRTHTGEKPYKCPECGKSFS   88 (190)
T ss_dssp             -----------CCSSHHHHHGGGC--C-----------CCEECTTTCCEESSH-HHHHHHHHHHHCCCCEECTTTCCEES
T ss_pred             CCCcCCCCccccCCHHHHHHHHHH--cC--------CCCCccCCCcCchhCCH-HHHHHHHHhcCCCCCccCcccCCccC
Confidence            479999999999999999999998  42        22334333    34433 56888888888888999999999999


Q ss_pred             ChHHHHHHHhhh
Q 020332           78 SSKALAQHLNSR   89 (327)
Q Consensus        78 s~~~l~~Hl~sk   89 (327)
                      +...|..|++..
T Consensus        89 ~~~~l~~H~~~h  100 (190)
T 2i13_A           89 QRANLRAHQRTH  100 (190)
T ss_dssp             CHHHHHHHHHHH
T ss_pred             CHHHHHHHHHhc
Confidence            999999998753



>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.04
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.65
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.46
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.41
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.39
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.38
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.36
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.29
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 98.05
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.94
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.82
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.77
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 97.76
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.63
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.59
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.58
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.56
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.54
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.52
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.49
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.48
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.46
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 97.38
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.34
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 97.3
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.28
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.27
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.26
d2cota238 Zinc finger and SCAN domain-containing protein 16, 97.23
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.19
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.17
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.15
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.14
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.12
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.0
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.97
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.96
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.96
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.88
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 96.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.74
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 96.53
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.49
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.96
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.94
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.84
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 95.83
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.77
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.73
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.49
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.48
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.3
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.08
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.08
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.93
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 94.86
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.44
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 94.38
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.35
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 94.16
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.06
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.46
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.3
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.17
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.67
d1y0jb136 U-shaped transcription factor, different fingers { 92.06
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.8
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.74
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.43
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 91.21
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 91.15
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.08
d1y0jb136 U-shaped transcription factor, different fingers { 91.03
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.98
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.22
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.04
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 89.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 89.4
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.09
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.02
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 88.91
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 88.84
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.58
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 88.42
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 87.66
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.43
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 86.19
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.02
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 85.76
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 85.73
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 85.54
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 85.24
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 85.1
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 84.48
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.82
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 83.5
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 82.83
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 81.18
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 80.88
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 80.74
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04  E-value=3.6e-11  Score=83.03  Aligned_cols=51  Identities=25%  Similarity=0.673  Sum_probs=46.4

Q ss_pred             CCccccccccccCChHHHhccccccccccchhhhhcCCCCccHHHHHHHHHHHHHHhhhcCCCCeeecCCcCCcccChHH
Q 020332            2 PGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEALFLARQAALAQEKNKNATPMTYSCGLCGKGYRSSKA   81 (327)
Q Consensus         2 ~~f~C~~C~~~F~~~~~lr~H~ksdwHryNlKRkva~lppv~~~~F~~k~~~l~~~~~~h~~~~~~~C~~C~K~F~s~~~   81 (327)
                      .||+|. ||++|.....|+.|+++  |                                 +++++|.|.+||+.|...+.
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~--H---------------------------------t~ekpy~C~~C~k~F~~~~~   45 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSM--H---------------------------------LGLRPYGCGVCGKKFKMKHH   45 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHH--H---------------------------------SCCCSEECTTTSCEESSSHH
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhc--c---------------------------------ccccCCcCCCcCCEecCHHH
Confidence            589995 99999999999999887  4                                 47899999999999999999


Q ss_pred             HHHHHhh
Q 020332           82 LAQHLNS   88 (327)
Q Consensus        82 l~~Hl~s   88 (327)
                      |..|+++
T Consensus        46 L~~H~r~   52 (53)
T d2csha1          46 LVGHMKI   52 (53)
T ss_dssp             HHHHHTT
T ss_pred             HHHHHhc
Confidence            9999975



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure