Citrus Sinensis ID: 020360


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MEACPSCGSEYFRDFEVETIGLKETSRRCSDLKCGAKLRDTVLDWEDALPPKEMNPAEKHCKIADVVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTPKDKKASLVIHGFVDKVVAGVMDLLNLRIPPYIRIDLLQIIVTQSLSSDKKFVNWTLRITSVHGQTAQLPFIKSVEVSFSDRQKYKEASLDKQPFQLKRRTVINETFDIKLKLNFSDGCGCPCTQINIPFDFKVPPKCFELDKDDIFQRLRETAFQDLGCGQNEVIERKVLSSPKSEVTVYAIVSNVKTFESNCLSNGDLKWLKDGVNGTETSKKRSNSRKRKSRS
cccccccccccccccHHHHcccccccccccccccccEEEccEECccccccHHHHHHHHHHHHHccEEEEEcccccCCccccccHHHHHcccEEEEEcccccccccccCEEEEccHHHHHHHHHHHHcccccccccccccEEEEEEEccccccEEEEEEEEEEccccccccccEEEEEEEccccccccccccccccCEEEEEEcccccEEEEEEEEEccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccccccccc
MEACPSCGSEYFRDFEVETIGLKETSRRCSDLKCGAKLRDTVLDWEDALPPKEMNPAEKHCKIADVVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTPKDKKASLVIHGFVDKVVAGVMDLLNLRIPPYIRIDLLQIIVTQSLSSDKKFVNWTLRITSVHGQTAQLPFIKSVEVSFS*********LDKQPFQLKRRTVINETFDIKLKLNFSDGCGCPCTQINIPFDFKVPPKCFELDKDDIFQRLRETAFQDLGCGQNEVIERKVLSSPKSEVTVYAIVSNVKTFESNCLSN*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEACPSCGSEYFRDFEVETIGLKETSRRCSDLKCGAKLRDTVLDWEDALPPKEMNPAEKHCKIADVVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTPKDKKASLVIHGFVDKVVAGVMDLLNLRIPPYIRIDLLQIIVTQSLSSDKKFVNWTLRITSVHGQTAQLPFIKSVEVSFSDRQKYKEASLDKQPFQLKRRTVINETFDIKLKLNFSDGCGCPCTQINIPFDFKVPPKCFELDKDDIFQRLRETAFQDLGCGQNEVIERKVLSSPKSEVTVYAIVSNVKTFESNCLSNGDLKWLKDGVNGTETSKKRSNSRKRKSRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAD-dependent protein deacetylase SRT1 NAD-dependent protein deacetylase. Has deacetylase activity towards H3K9Ac. May have a function in the safeguard against genome instabiliy and DNA damage to ensure plant cell growth.probableQ9FE17

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K35, chain A
Confidence level:very confident
Coverage over the Query: 2-135
View the alignment between query and template
View the model in PyMOL
Template: 3QRL, chain A
Confidence level:probable
Coverage over the Query: 138-252
View the alignment between query and template
View the model in PyMOL