BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020434
(326 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2P5D|A Chain A, Crystal Structure Of Mjecl36 From Methanocaldococcus
Jannaschii Dsm 2661
Length = 147
Score = 32.3 bits (72), Expect = 0.41, Method: Compositional matrix adjust.
Identities = 20/104 (19%), Positives = 48/104 (46%), Gaps = 8/104 (7%)
Query: 202 ETIGGYIFVCNNDTMAENLKRQLFGLPPRYRDSVRAITPGLPLFLY-------NYSTHQL 254
+ + ++ + N D +++++G+ RY++++ + G L +Y +Y +
Sbjct: 2 DLMAYWLCITNEDNWKVIKEKKIWGVAERYKNTINKVKVGDKLIIYEIQRSGKDYKPPYI 61
Query: 255 HGIFEAASFGGTNIDPTAWEDKKCPGESRFPAQVRVVTRKICEP 298
G++E S + + P E +FP +V++ K+ EP
Sbjct: 62 RGVYEVVSEVYKDSSKIFKPTPRNPNE-KFPYRVKLKEIKVFEP 104
>pdb|1JW1|A Chain A, Crystallization And Structure Determination Of Goat
Lactoferrin At 4.0 Resolution: A New Form Of Packing In
Lactoferrins With A High Solvent Content In Crystals
Length = 689
Score = 28.5 bits (62), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNFD 48
N+++ ++ ++ R A ++ +++ ND++W N G D KN +
Sbjct: 518 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESSADWAKNLN 565
>pdb|1BIY|A Chain A, Structure Of Diferric Buffalo Lactoferrin
Length = 689
Score = 28.5 bits (62), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNFD 48
N+++ ++ ++ R A ++ +++ ND++W N G D KN +
Sbjct: 518 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLN 565
>pdb|1CE2|A Chain A, Structure Of Diferric Buffalo Lactoferrin At 2.5a
Resolution
Length = 689
Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNFD 48
N+++ ++ ++ R A ++ +++ ND++W N G D KN +
Sbjct: 518 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLN 565
>pdb|2B65|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Bovine
Lactoferrin With Maltose At 1.5a Resolution
pdb|2FA7|A Chain A, Crystal Structure Of The Complex Of Bovine Lactoferrin
C-Lobe With A Pentasaccharide At 2.38 A Resolution
pdb|2DOJ|A Chain A, Crystal Structure Of The Complex Of C-Terminal Lobe Of
Bovine Lactoferrin With Adenosine At 2.4 A Resolution
pdb|2DP8|A Chain A, Carbohydrate Recognition By Lactoferrin: Crystal Structure
Of The Complex Of C-Terminal Lobe Of Bovine Lactoferrin
With Trisaccharide At 2.5 A Resolution
pdb|2G93|A Chain A, Ligand Recognition Site In C-Lobe Of Lactoferrin: Crystal
Structure Of The Complex Of C-Lobe Of Bovine Lactoferrin
With Methyl Alpha-D- Mannopyranoside At 1.9 A Resolution
pdb|2H4I|A Chain A, Crystal Structure Of The Complex Of Proteolytically
Produced C- Terminal Half Of Bovine Lactoferrin With
Lactose At 2.55 A Resolution
pdb|2HCA|A Chain A, Crystal Structure Of Bovine Lactoferrin C-Lobe Liganded
With Glucose At 2.8 A Resolution
pdb|2DQV|A Chain A, Structure Of The C-Terminal Lobe Of Bovine Lactoferrin In
Complex With Galactose At 2.7 A Resolution
pdb|2DS9|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With Mannose At 2.8 A Resolution
pdb|2DSF|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With Xylose At 2.8a Resolution
pdb|2DVC|A Chain A, Structure Of The Bovine Lactoferrin C-Lobe Complex With
Sucrose At 3.0 A Resolution
pdb|2DWA|A Chain A, Structure Of The Complex Of Lactoferrin C-Terminal Half
With Fucose At 2.07 A Resolution
pdb|2DWH|A Chain A, Crystal Structure Of N-Acetylglucosamine Complex Of Bovine
Lactoferrin C-Lobe At 2.8 A Resolution
pdb|2DWI|A Chain A, Crystal Structure Of The Complex Formed Between C-Terminal
Half Of Bovine Lactoferrin And Cellobiose At 2.2 A
Resolution
pdb|2DWJ|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With Raffinose At 2.3 A Resolution
pdb|2DXR|A Chain A, Crystal Structure Of The Complex Formed Between C-Terminal
Half Of Bovine Lactoferrin And Sorbitol At 2.85 A
Resolution
pdb|2DXY|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With Trehalose At 2.0 A Resolution
pdb|2DYX|A Chain A, Structure Of The Complex Of Lactoferrin C-lobe With
Melibiose At 2.0 A Resolution
pdb|2E0S|A Chain A, Carbohydrate Recognition Of C-Terminal Half Of
Lactoferrin: Crystal Structure Of The Complex Of C-Lobe
With Rhamnose At 2.15 A Resolution
pdb|2E1S|A Chain A, Crystal Structure Of The Complex Of C-Terminal Half Of
Bovine Lactoferrin And Arabinose At 2.7 A Resolution
pdb|2NWJ|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With Disaccharide At 1.75 A Resolution
pdb|2NUV|A Chain A, Crystal Structure Of The Complex Of C-Terminal Lobe Of
Bovine Lactoferrin With Atenolol At 2.25 A Resolution
pdb|2O1L|A Chain A, Structure Of A Complex Of C-terminal Lobe Of Bovine
Lactoferrin With Disaccharide At 1.97 A Resolution
pdb|2O51|A Chain A, Crystal Structure Of Bovine C-Lobe With Fructose At 3.0 A
Resolution
pdb|2OCU|A Chain A, Structure Of The Complex Of C-Terminal Lobe Of Bovine
Lactoferrin With N-(4-Hydroxyphenyl) Acetamide At 2.38 A
Resolution
pdb|2PX1|A Chain A, Crystal Structure Of The Complex Of Bovine Lactoferrin
C-Lobe With Ribose At 2.5 A Resolution
pdb|2R71|A Chain A, Crystal Structure Of The Complex Of Bovine C-lobe With
Inositol At 2.1a Resolution
pdb|2R9J|A Chain A, Ligand Recognition In C-Lobe: The Crystal Structure Of The
Complex Of Lactoferrin C-Lobe With Nicotinamide At 2.5 A
Resolution
pdb|3CFL|A Chain A, Crystal Structure Of The Complex Formed Between C-lobe Of
Bovine Lactoferrin And
5-chloro-6'-methyl-3-[4-(methylsulfonyl)phenyl]-2,3'-
Bipyridine At 2.25 A Resolution
pdb|3CI8|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Lactoferrin
With Vitamin B3 (Niacin) At 2.4 A Resolution
pdb|3CRB|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Lactoferrin
With 2- Chromenone At 2.6 A Resolution
pdb|2ZMB|A Chain A, Crystal Structure Of The Complex Of C-Terminal Lobe Of
Bovine Lactoferrin With Parecoxib At 2.9 A Resolution
pdb|3E9X|A Chain A, Crystal Structure Of The Complex Of C-lobe Of Lactoferrin
With Nimesulide At 2.7 A Resolution
pdb|3IB2|A Chain A, Structure Of The Complex Of C-Terminal Half (C-Lobe) Of
Bovine Lactoferrin With Alpha-Methyl-4-(2-Methylpropyl)
Benzene Acetic Acid
pdb|3IAZ|A Chain A, Structural Basis Of The Prevention Of Nsaid-induced Damage
Of The Gastrointestinal Tract By C-terminal Half
(c-lobe) Of Bovine Colostrum Protein Lactoferrin:
Binding And Structural Studies Of The C-lobe Complex
With Aspirin
pdb|3IB0|A Chain A, Structural Basis Of The Prevention Of Nsaid-Induced Damage
Of The Gastrointestinal Tract By C-Terminal Half
(C-Lobe) Of Bovine Colostrum Protein Lactoferrin:
Binding And Structural Studies Of C- Lobe Complex With
Diclofenac
pdb|3IB1|A Chain A, Structural Basis Of The Prevention Of Nsaid-Induced Damage
Of The Gastrointestinal Tract By C-Terminal Half
(C-Lobe) Of Bovine Colostrum Protein Lactoferrin:
Binding And Structural Studies Of C- Lobe Complex With
Indomethacin
pdb|3K0V|A Chain A, Removal Of Sugars And Sugars-Like Molecules From The
Solution By C- Lobe Of Lactoferrin: Crystal Structure Of
The Complex Of C-Lobe With
Beta-D-Glucopyranosyl-(1->4)-Beta-D-Galactopyranosyl-(1-
>4)-Alpha-D- Glucopyranose At 1.9 A Resolution
pdb|3KJ7|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Bovine
Lactoferrin With Dextrin At 1.9 A Resolution
pdb|3MJN|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Lactoferrin
With Isopropylamino-3-(1-Naphthyloxy)propan-2-Ol At 2.38
A Resolution
pdb|3O97|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Lactoferrin
With Indole Acetic Acid At 2.68 A Resolution
pdb|3RGY|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Lipopolysaccharide At 2.0 A Resolution
pdb|3SDF|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Lipoteichoic Acid At 2.1 A Resolution
pdb|3TAJ|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Nabumetone At 1.7a Resolution
pdb|3TTR|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Lidocaine At 2.27 A Resolution
pdb|3TUS|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Meta- Hydroxy Benzoic Acid At 2.5 A
Resolution
pdb|4G77|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Tolfenamic Acid At 1.98 A Resolution
pdb|4G8H|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Licofelone At 1.88 A Resolution
Length = 345
Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 11/47 (23%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNF 47
N+++ ++ ++ R A ++ +++ ND++W N G D KN
Sbjct: 177 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNL 223
>pdb|2P1S|A Chain A, Crystal Structure Of The C-Terminal Lobe Of Bovine
Lactoferrin Complexed With O-Alpha-D-Glucopyranosyl-(1
3)-Alpha-D- Fructofuranosyl- (2 1)-
Alpha-D-Glucopyranoside At 1.93 A Resolution
Length = 344
Score = 28.5 bits (62), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 11/47 (23%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNF 47
N+++ ++ ++ R A ++ +++ ND++W N G D KN
Sbjct: 177 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNL 223
>pdb|1SDX|A Chain A, Crystal Structure Of The Zinc Saturated C-Terminal Half Of
Bovine Lactoferrin At 2.0 A Resolution Reveals Two
Additional Zinc Binding Sites
pdb|3TOD|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With 1- Butyl-1h-Pyrazole-5-Carboxylic Acid At
1.38 A Resolution
pdb|3U72|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Isoniazid At 2.2 A Resolution
pdb|3U8Q|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Phenyl-Propanolamine At 1.97 A Resolution
pdb|3UGW|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Deoxycytidine At 1.87 A Resolution
pdb|3UK4|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With 1,2, 5-Pentanetriol At 1.98 A Resolution
pdb|3USD|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Imidazol (1,2 A) Pyridine3-Yl-Acitic Acid
At 2.4 A Resolution
pdb|3V5A|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Gamma Amino Butyric Acid At 1.44 A
Resolution
pdb|3VDF|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Diaminopimelic Acid At 1.46 A Resolution
pdb|4DIG|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With N- Acetylmuramyl L-Alanyl D-Isoglutamine
At 1.8 A Resolution
pdb|4DXU|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Aminocaproic Acid At 1.46 A Resolution
pdb|4FIM|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Celecoxib Acid At 1.80 A Resolution
pdb|4FJP|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Naproxen At 1.68 A Resolution
pdb|4FOR|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Flurbiprofen At 1.58 A Resolution
pdb|4G2Z|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Mefenamic Acid At 1.90 A Resolution
pdb|4GRK|A Chain A, Crystal Structure Of C-Lobe Of Bovine Lactoferrin
Complexed With Ketorolac At 1.68 A Resolution
Length = 335
Score = 28.5 bits (62), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 11/47 (23%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNF 47
N+++ ++ ++ R A ++ +++ ND++W N G D KN
Sbjct: 177 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNL 223
>pdb|1NKX|A Chain A, Crystal Structure Of A Proteolytically Generated
Functional Monoferric C-Lobe Of Bovine Lactoferrin At
1.9a Resolution
pdb|2ALU|A Chain A, Detection Of New Binding Site In The C-Terminal Lobe Of
Lactoferrin:crystal Structure Of The Complex Formed
Between Bovine Lactoferrin And A Tetrasaccharide At 2.1a
Resolution
pdb|2AYS|A Chain A, A Conserved Non-Metallic Binding Site In The C-Terminal
Lobe Of Lactoferrin: Structure Of The Complex Of
C-Terminal Lobe Of Bovine Lactoferrin With N-Acetyl
Galactosamine At 1.86 A Resolution
pdb|2Q8J|A Chain A, Crystal Structure Of The Complex Of C-Lobe Of Bovine
Lactoferrin With Mannitol And Mannose At 2.7 A
Resolution
pdb|2QJE|A Chain A, Crystal Structure Of The Complex Of Bovine C-Lobe With
Amygdalin At 2.3a Resolution
Length = 348
Score = 28.5 bits (62), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 11/47 (23%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNF 47
N+++ ++ ++ R A ++ +++ ND++W N G D KN
Sbjct: 177 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNL 223
>pdb|1BLF|A Chain A, Structure Of Diferric Bovine Lactoferrin At 2.8 Angstroms
Resolution
Length = 689
Score = 28.5 bits (62), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Query: 3 NNQQSFWQFSDQLRVQASNLANLSL--NDSIWSNNYGSKRPDERKNFD 48
N+++ ++ ++ R A ++ +++ ND++W N G D KN +
Sbjct: 518 NSKEKYYGYTGAFRCLAEDVGDVAFVKNDTVWENTNGESTADWAKNLN 565
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.136 0.413
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,636,189
Number of Sequences: 62578
Number of extensions: 377921
Number of successful extensions: 654
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 651
Number of HSP's gapped (non-prelim): 12
length of query: 326
length of database: 14,973,337
effective HSP length: 99
effective length of query: 227
effective length of database: 8,778,115
effective search space: 1992632105
effective search space used: 1992632105
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)