Citrus Sinensis ID: 020457


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQNP
ccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccEEEEEEccccEEEEcccccEEEEEEEcccccccEEEEEcccccEEEEccccEEEEEcccccHHHHHHHHHHHccc
cccccccccHHHEEEcccccEEEccccccEEccccccccccccccccccccccEcHHHccHHHHccccEccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccHHHHccHHHccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHccccccEEEccccccccccHHHHHHHHHHcccccEEEEccHHHEEccccccccccccccEEEccccEEEEEccccEEEEEcccccHHHHHHHHHHHccc
mglihrdikpenllltadghikiadfgsvkpmqdsritvlpnaasddkactfvgtaayvppevlnsspatfgndlwALGCTLyqmlsgtspfkdtsEWLIFQRIIArdirfpnyfSDAARDLIDRLldvdpsgrpgagpggyavlkmhpffkgidwknirgqtppklasepmvqsgegddvhdsswnpshigdisakindgnggasssegsITRLAsidsfdskwqqfldpgeSVLMISMVKKLQKLTSKKVQLIltnkpkliyvdpsklvvkgniiwsdnsndlsiqvsspshfkivtpkkvlSFEDAKQRASQWKKAIEALQNP
mglihrdikpenllltADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKvqliltnkpkliyvdpsKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQNP
MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSdaardlidrlldvdPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQNP
**********ENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDP*****AGPGGYAVLKMHPFFKGIDWKNIR*********************************************************IDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQV****HFKIVTP**************************
MGLIHRDIKPENLLLTADGHIKIADFGSVKPM******************TFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDV************************************************DPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSND****VSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQ**
MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPP*****************DSSWNPSHIGDISAKINDG*********SITRLASIDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFE*******************
MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQD*R***LPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHI******************************DSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQNP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query326 2.2.26 [Sep-21-2011]
Q4V3C8486 3-phosphoinositide-depend yes no 0.993 0.666 0.846 1e-161
Q9XF67491 3-phosphoinositide-depend no no 0.996 0.661 0.827 1e-159
Q9Z2A0559 3-phosphoinositide-depend yes no 0.950 0.554 0.346 5e-50
O15530556 3-phosphoinositide-depend yes no 0.950 0.557 0.343 1e-49
O55173559 3-phosphoinositide-depend yes no 0.950 0.554 0.343 1e-49
Q9W0V1836 3-phosphoinositide-depend yes no 0.825 0.321 0.353 2e-43
Q6A1A2396 Putative 3-phosphoinositi no no 0.542 0.446 0.449 2e-39
Q54PK9 908 3-phosphoinositide-depend yes no 0.487 0.175 0.404 2e-30
Q2RBR1921 Phototropin-1B OS=Oryza s no no 0.503 0.178 0.408 6e-30
Q2QYY8921 Phototropin-1A OS=Oryza s no no 0.503 0.178 0.408 6e-30
>sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  567 bits (1461), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 275/325 (84%), Positives = 292/325 (89%), Gaps = 1/325 (0%)

Query: 1   MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 60
           MGLIHRDIKPENLLLT DGHIKIADFGSVKPMQDS+ITVLPNAASDDKACTFVGTAAYVP
Sbjct: 162 MGLIHRDIKPENLLLTLDGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVP 221

Query: 61  PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAAR 120
           PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKD SEWLIFQRIIARDI+FPN+FS+AAR
Sbjct: 222 PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAAR 281

Query: 121 DLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDD 180
           DLIDRLLD DPS RPGAG  GY  LK HPFFKG+DWKN+R QTPPKLA +P  QS    +
Sbjct: 282 DLIDRLLDTDPSRRPGAGSEGYDSLKRHPFFKGVDWKNLRSQTPPKLAPDPASQSA-SPE 340

Query: 181 VHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISM 240
              S WNP+H+GD S   NDG+ G S S GSITRLASIDSFDS+WQQFL+PGESVLMIS 
Sbjct: 341 RDGSPWNPTHVGDTSVLQNDGHNGLSESSGSITRLASIDSFDSRWQQFLEPGESVLMISA 400

Query: 241 VKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTP 300
           VKKLQK+TSKKVQLILTNKP+LIYVDPSKLVVKGNIIWSDNSNDL++QVSSPSHFKI TP
Sbjct: 401 VKKLQKITSKKVQLILTNKPRLIYVDPSKLVVKGNIIWSDNSNDLNVQVSSPSHFKICTP 460

Query: 301 KKVLSFEDAKQRASQWKKAIEALQN 325
           KKVLSFEDAKQRA QWKKAIE LQN
Sbjct: 461 KKVLSFEDAKQRALQWKKAIETLQN 485





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 Back     alignment and function description
>sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 Back     alignment and function description
>sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 Back     alignment and function description
>sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 Back     alignment and function description
>sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2 PE=5 SV=1 Back     alignment and function description
>sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 Back     alignment and function description
>sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 Back     alignment and function description
>sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
255586617 506 3-phosphoinositide-dependent protein kin 0.996 0.642 0.875 1e-167
296090372 468 unnamed protein product [Vitis vinifera] 0.993 0.692 0.859 1e-163
225449645 502 PREDICTED: 3-phosphoinositide-dependent 0.987 0.641 0.856 1e-161
224109900 496 predicted protein [Populus trichocarpa] 0.996 0.655 0.853 1e-160
297829596 486 hypothetical protein ARALYDRAFT_897238 [ 0.993 0.666 0.849 1e-160
350539745 494 3-phosphoinositide-dependent protein kin 0.996 0.657 0.860 1e-160
12322773 483 putative 3-phosphoinositide-dependent pr 0.993 0.670 0.846 1e-159
30681369 486 3-phosphoinositide-dependent protein kin 0.993 0.666 0.846 1e-159
110743925 486 3-phosphoinositide-dependent protein kin 0.993 0.666 0.846 1e-159
18414583 491 3'-phosphoinositide-dependent protein ki 0.996 0.661 0.827 1e-157
>gi|255586617|ref|XP_002533941.1| 3-phosphoinositide-dependent protein kinase-1, putative [Ricinus communis] gi|223526096|gb|EEF28448.1| 3-phosphoinositide-dependent protein kinase-1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/328 (87%), Positives = 306/328 (93%), Gaps = 3/328 (0%)

Query: 1   MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 60
           MGLIHRDIKPENLLLTADGHIK+ADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP
Sbjct: 178 MGLIHRDIKPENLLLTADGHIKVADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 237

Query: 61  PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAAR 120
           PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKD SEWLIFQRIIARDIRFPNYFS+ AR
Sbjct: 238 PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIRFPNYFSEEAR 297

Query: 121 DLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDD 180
           D+IDRLLD+DPS RPGAGP GYA LK+HPFFKGI+WKN+R +TPPKLA E M QSG+G+ 
Sbjct: 298 DIIDRLLDIDPSRRPGAGPEGYAALKIHPFFKGINWKNLREETPPKLALEAMTQSGDGEL 357

Query: 181 VHDSSWNPSHIGDISAKINDGNGGASSS---EGSITRLASIDSFDSKWQQFLDPGESVLM 237
             D++WNP+HIGD SA+ NDG GG SS+    GSITRLASIDSFDSKWQQFLDPGESVLM
Sbjct: 358 DPDATWNPTHIGDGSARQNDGTGGPSSTAEASGSITRLASIDSFDSKWQQFLDPGESVLM 417

Query: 238 ISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKI 297
           ISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKL+VKGNIIWSDNSNDLS+QVSSPSHFKI
Sbjct: 418 ISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLLVKGNIIWSDNSNDLSVQVSSPSHFKI 477

Query: 298 VTPKKVLSFEDAKQRASQWKKAIEALQN 325
            TPKKV+SFEDAKQRA QWKKAIE+LQN
Sbjct: 478 FTPKKVMSFEDAKQRAWQWKKAIESLQN 505




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296090372|emb|CBI40191.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449645|ref|XP_002262670.1| PREDICTED: 3-phosphoinositide-dependent protein kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109900|ref|XP_002315349.1| predicted protein [Populus trichocarpa] gi|222864389|gb|EEF01520.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297829596|ref|XP_002882680.1| hypothetical protein ARALYDRAFT_897238 [Arabidopsis lyrata subsp. lyrata] gi|297328520|gb|EFH58939.1| hypothetical protein ARALYDRAFT_897238 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|350539745|ref|NP_001234519.1| 3-phosphoinositide-dependent protein kinase-1 [Solanum lycopersicum] gi|57168305|gb|AAW38936.1| 3-phosphoinositide-dependent protein kinase-1 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|12322773|gb|AAG51370.1|AC011560_2 putative 3-phosphoinositide-dependent protein kinase-1; 57432-54928 [Arabidopsis thaliana] gi|8567784|gb|AAF76356.1| 3-phosphoinositide-dependent protein kinase-1, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30681369|ref|NP_187665.2| 3-phosphoinositide-dependent protein kinase [Arabidopsis thaliana] gi|75316154|sp|Q4V3C8.1|PDPK2_ARATH RecName: Full=3-phosphoinositide-dependent protein kinase 2; Short=AtPDK2 gi|66792634|gb|AAY56419.1| At3g10540 [Arabidopsis thaliana] gi|95147296|gb|ABF57283.1| At3g10540 [Arabidopsis thaliana] gi|332641402|gb|AEE74923.1| 3-phosphoinositide-dependent protein kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110743925|dbj|BAE99796.1| 3-phosphoinositide-dependent protein kinase-1 like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18414583|ref|NP_568138.1| 3'-phosphoinositide-dependent protein kinase 1 [Arabidopsis thaliana] gi|75267395|sp|Q9XF67.1|PDPK1_ARATH RecName: Full=3-phosphoinositide-dependent protein kinase 1; Short=AtPDK1 gi|5001828|gb|AAD37165.1|AF132742_1 3-phosphoinositide-dependent protein kinase-1 [Arabidopsis thaliana] gi|13430828|gb|AAK26036.1|AF360326_1 putative 3-phosphoinositide-dependent protein kinase-1 PDK1 [Arabidopsis thaliana] gi|15810595|gb|AAL07185.1| putative 3-phosphoinositide-dependent protein kinase-1 PDK1 [Arabidopsis thaliana] gi|332003372|gb|AED90755.1| 3'-phosphoinositide-dependent protein kinase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
TAIR|locus:2075740486 AT3G10540 [Arabidopsis thalian 0.993 0.666 0.809 8e-140
TAIR|locus:2184357491 PDK1 "3'-phosphoinositide-depe 0.996 0.661 0.796 5.1e-138
UNIPROTKB|F1Q2Y3558 PDPK1 "Uncharacterized protein 0.634 0.370 0.377 7.3e-46
FB|FBgn0020386836 Pdk1 "Phosphoinositide-depende 0.530 0.206 0.358 3.2e-44
DICTYBASE|DDB_G0281471686 pdkA "PDK1 family protein kina 0.414 0.196 0.338 4.1e-44
UNIPROTKB|Q5F3U4556 PDPK1 "Uncharacterized protein 0.656 0.384 0.376 4.5e-44
UNIPROTKB|E1BSA6560 PDPK1 "Uncharacterized protein 0.656 0.382 0.376 5e-44
UNIPROTKB|E9PER6529 PDPK1 "3-phosphoinositide-depe 0.613 0.378 0.380 5.4e-44
MGI|MGI:1338068559 Pdpk1 "3-phosphoinositide depe 0.622 0.363 0.384 8.4e-44
UNIPROTKB|O15530556 PDPK1 "3-phosphoinositide-depe 0.613 0.359 0.380 1.4e-43
TAIR|locus:2075740 AT3G10540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1368 (486.6 bits), Expect = 8.0e-140, P = 8.0e-140
 Identities = 263/325 (80%), Positives = 279/325 (85%)

Query:     1 MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 60
             MGLIHRDIKPENLLLT DGHIKIADFGSVKPMQDS+ITVLPNAASDDKACTFVGTAAYVP
Sbjct:   162 MGLIHRDIKPENLLLTLDGHIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVP 221

Query:    61 PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSXXXX 120
             PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKD SEWLIFQRIIARDI+FPN+FS    
Sbjct:   222 PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAAR 281

Query:   121 XXXXXXXXXXPSGRPGAGPGGYAVLKMHPFFKGIDWKNIRGQTPPKLASEPMVQSGEGDD 180
                       PS RPGAG  GY  LK HPFFKG+DWKN+R QTPPKLA +P  QS   + 
Sbjct:   282 DLIDRLLDTDPSRRPGAGSEGYDSLKRHPFFKGVDWKNLRSQTPPKLAPDPASQSASPER 341

Query:   181 VHDSSWNPSHIGDISAKINDGNGGASSSEGSITRLASIDSFDSKWQQFLDPGESVLMISM 240
                S WNP+H+GD S   NDG+ G S S GSITRLASIDSFDS+WQQFL+PGESVLMIS 
Sbjct:   342 -DGSPWNPTHVGDTSVLQNDGHNGLSESSGSITRLASIDSFDSRWQQFLEPGESVLMISA 400

Query:   241 VKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVSSPSHFKIVTP 300
             VKKLQK+TSKKVQLILTNKP+LIYVDPSKLVVKGNIIWSDNSNDL++QVSSPSHFKI TP
Sbjct:   401 VKKLQKITSKKVQLILTNKPRLIYVDPSKLVVKGNIIWSDNSNDLNVQVSSPSHFKICTP 460

Query:   301 KKVLSFEDAKQRASQWKKAIEALQN 325
             KKVLSFEDAKQRA QWKKAIE LQN
Sbjct:   461 KKVLSFEDAKQRALQWKKAIETLQN 485




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
TAIR|locus:2184357 PDK1 "3'-phosphoinositide-dependent protein kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2Y3 PDPK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0020386 Pdk1 "Phosphoinositide-dependent kinase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281471 pdkA "PDK1 family protein kinase PdkA" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3U4 PDPK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSA6 PDPK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PER6 PDPK1 "3-phosphoinositide-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1338068 Pdpk1 "3-phosphoinositide dependent protein kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O15530 PDPK1 "3-phosphoinositide-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4V3C8PDPK2_ARATH2, ., 7, ., 1, 1, ., 10.84610.99380.6666yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.946
3rd Layer2.7.110.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00010800001
SubName- Full=Chromosome chr13 scaffold_286, whole genome shotgun sequence; (515 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-68
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-52
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 1e-51
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 7e-48
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-46
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-44
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 5e-44
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-40
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-39
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-39
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-38
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-38
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 6e-36
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 8e-36
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-35
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 8e-35
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-34
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-34
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-34
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 6e-34
cd01262107 cd01262, PH_PDK1, 3-Phosphoinositide dependent pro 1e-33
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 1e-33
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 5e-33
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 8e-33
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-32
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 4e-32
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 5e-32
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 8e-32
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-31
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-31
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 5e-31
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 2e-30
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-30
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-30
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 5e-30
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 7e-30
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 9e-30
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-29
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 2e-29
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 2e-29
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-29
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-29
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-29
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 4e-29
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 5e-29
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 7e-29
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 7e-29
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 9e-29
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 9e-29
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-28
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-28
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 3e-28
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 5e-28
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 2e-27
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-27
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-26
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-26
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 8e-26
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 1e-25
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-25
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 7e-25
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 9e-25
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-24
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 2e-24
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 6e-24
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 9e-24
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-23
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-23
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-23
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 9e-23
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 3e-22
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-22
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 4e-22
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 8e-22
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-21
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-21
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-21
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 4e-21
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 6e-21
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 8e-21
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 4e-20
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-20
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-20
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 8e-20
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 9e-20
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-19
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 2e-19
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-19
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 4e-19
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-19
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-18
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 2e-18
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 2e-18
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 4e-18
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 6e-18
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 8e-18
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 2e-17
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-17
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-17
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 4e-17
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 5e-17
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 9e-17
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-16
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 1e-16
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 1e-16
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 2e-16
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 2e-16
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-16
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 4e-16
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 4e-16
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 4e-16
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-16
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 7e-16
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 8e-16
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 8e-16
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 9e-16
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-15
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 1e-15
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-15
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-15
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-15
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 3e-15
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 3e-15
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 4e-15
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 4e-15
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 8e-15
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-14
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-14
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-14
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 7e-14
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 7e-14
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 8e-14
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 1e-13
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-13
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-13
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-13
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-13
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-13
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-13
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 5e-13
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 8e-13
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 1e-12
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-12
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-12
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-12
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 2e-12
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 2e-12
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-12
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 3e-12
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-12
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 3e-12
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 4e-12
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 4e-12
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 6e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 7e-12
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 7e-12
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 1e-11
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-11
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 2e-11
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 2e-11
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 5e-11
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 7e-11
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 9e-11
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 1e-10
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 1e-10
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 1e-10
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 3e-10
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 3e-10
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 4e-10
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 5e-10
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 7e-10
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 7e-10
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 8e-10
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-09
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-09
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-09
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 1e-09
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-09
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 2e-09
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-09
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 2e-09
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 2e-09
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-09
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 3e-09
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 3e-09
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 3e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 6e-09
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 6e-09
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 7e-09
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 8e-09
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 8e-09
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-08
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 1e-08
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-08
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 1e-08
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 2e-08
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-08
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 2e-08
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-08
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 5e-08
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 6e-08
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 7e-08
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 9e-08
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 9e-08
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 1e-07
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 2e-07
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 3e-07
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-07
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 5e-07
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 6e-07
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 6e-07
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 7e-07
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 8e-07
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 9e-07
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 1e-06
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-06
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-06
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-06
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-06
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 3e-06
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 3e-06
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 4e-06
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 6e-06
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-05
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 2e-05
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-05
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-05
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 3e-05
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 3e-05
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 3e-05
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 3e-05
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 3e-05
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 4e-05
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 5e-05
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 6e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 7e-05
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-04
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-04
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-04
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-04
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-04
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 3e-04
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-04
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 3e-04
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 4e-04
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 5e-04
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 5e-04
smart00750176 smart00750, KIND, kinase non-catalytic C-lobe doma 6e-04
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 6e-04
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 6e-04
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 7e-04
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 9e-04
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 0.001
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 0.001
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 0.001
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 0.001
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.001
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 0.001
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.001
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 0.001
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 0.002
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 0.002
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 0.002
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 0.002
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 0.002
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 0.002
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 0.003
cd08227327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 0.003
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 0.003
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.003
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 0.003
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 0.003
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 0.004
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
 Score =  214 bits (548), Expect = 2e-68
 Identities = 74/161 (45%), Positives = 98/161 (60%), Gaps = 11/161 (6%)

Query: 1   MGLIHRDIKPENLLLTADGHIKIADFGSVKPM----------QDSRITVLPNAASDDKAC 50
            G+IHRD+KPEN+LL  D HIKI DFG+ K +           D+         +  +  
Sbjct: 121 KGIIHRDLKPENILLDKDMHIKITDFGTAKVLDPNSSPESNKGDATNIDSQIEKNRRRFA 180

Query: 51  TFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIR 110
           +FVGTA YV PE+LN  PA   +DLWALGC +YQML+G  PF+ ++E+L FQ+I+  +  
Sbjct: 181 SFVGTAEYVSPELLNEKPAGKSSDLWALGCIIYQMLTGKPPFRGSNEYLTFQKILKLEYS 240

Query: 111 FPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFF 151
           FP  F   A+DLI++LL +DP  R G    GY  LK HPFF
Sbjct: 241 FPPNFPPDAKDLIEKLLVLDPQDRLGVNE-GYDELKAHPFF 280


Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to autophosphorylate and is constitutively active in mammalian cells. PDK1 is essential for normal embryo development and is important in regulating cell volume. Length = 280

>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|241293 cd01262, PH_PDK1, 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|214801 smart00750, KIND, kinase non-catalytic C-lobe domain Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 326
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 99.97
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 99.97
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.97
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.97
PTZ00283496 serine/threonine protein kinase; Provisional 99.97
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.97
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.97
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.97
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.97
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.97
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
KOG0578550 consensus p21-activated serine/threonine protein k 99.96
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.96
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.96
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.96
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.96
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.96
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.96
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.96
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.96
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.96
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.96
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.96
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.96
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.96
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.96
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.96
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.96
KOG0198313 consensus MEKK and related serine/threonine protei 99.96
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.96
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.96
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.96
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.96
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.96
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.96
KOG0661538 consensus MAPK related serine/threonine protein ki 99.96
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.96
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.96
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.95
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.95
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.95
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.95
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.95
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.95
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.95
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.95
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.95
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.95
PTZ00284467 protein kinase; Provisional 99.95
PTZ00036440 glycogen synthase kinase; Provisional 99.95
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.95
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.95
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.95
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.95
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.95
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.95
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.94
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 99.94
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.94
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.94
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.94
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.94
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.94
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.94
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.94
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.94
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.94
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.94
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.94
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.94
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.94
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.94
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.94
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.94
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.94
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.94
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.94
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.94
KOG0595429 consensus Serine/threonine-protein kinase involved 99.94
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.94
KOG0596677 consensus Dual specificity; serine/threonine and t 99.94
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.94
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.94
PHA03212391 serine/threonine kinase US3; Provisional 99.94
PHA03207392 serine/threonine kinase US3; Provisional 99.94
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.94
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.93
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.93
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.93
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.93
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.93
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.93
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.93
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.93
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.93
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.92
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.92
KOG0589426 consensus Serine/threonine protein kinase [General 99.92
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.92
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.92
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.92
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.92
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.92
PHA03211461 serine/threonine kinase US3; Provisional 99.92
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.92
PHA03210501 serine/threonine kinase US3; Provisional 99.92
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.92
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.92
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.92
PHA02988283 hypothetical protein; Provisional 99.92
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.92
PHA03209357 serine/threonine kinase US3; Provisional 99.92
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.92
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.92
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.91
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.91
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.91
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.91
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.91
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.91
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.91
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.91
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.91
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.91
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.91
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.91
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.91
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.91
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.91
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.91
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.91
PHA02882294 putative serine/threonine kinase; Provisional 99.91
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.91
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.91
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.91
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.91
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.91
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.91
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.91
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.91
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.91
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.91
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.91
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.91
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.91
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.91
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.91
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.91
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.9
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.9
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.9
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.9
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.9
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.9
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.9
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.9
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.9
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.9
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.9
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.9
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.9
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.9
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.9
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.9
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.9
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.9
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.9
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.9
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.9
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.9
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.9
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.9
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.9
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.9
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.9
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.9
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.9
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.9
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.9
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.9
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.9
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.9
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.9
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.89
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.89
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.89
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.89
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.89
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.89
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.89
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.89
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.89
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.89
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.89
PLN00009294 cyclin-dependent kinase A; Provisional 99.89
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.89
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.89
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.89
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.89
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.89
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.89
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.89
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.89
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.89
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.89
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.89
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.89
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.89
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.89
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.89
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.89
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.89
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.89
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.89
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.89
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.89
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.89
KOG0584 632 consensus Serine/threonine protein kinase [General 99.89
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.89
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.89
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.89
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.89
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.89
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.89
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.89
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.89
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.89
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.89
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.89
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.89
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.89
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.89
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.89
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.89
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.89
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.89
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.89
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.89
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.89
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.88
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.88
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.88
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.88
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.88
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.88
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.88
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.88
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.88
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.88
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.88
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.88
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.88
KOG0586 596 consensus Serine/threonine protein kinase [General 99.88
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.88
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.88
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.88
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.88
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.88
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.88
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.88
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.88
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.88
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.88
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.88
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.88
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.88
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.88
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.88
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.88
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.88
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.88
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.88
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.88
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.88
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.88
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.88
KOG1027903 consensus Serine/threonine protein kinase and endo 99.88
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.88
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.88
PLN00181 793 protein SPA1-RELATED; Provisional 99.88
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.88
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.88
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.88
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.88
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.88
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.87
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.87
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.87
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.87
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.87
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.87
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.87
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.87
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.87
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.87
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.87
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.87
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.87
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.87
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.87
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.87
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.87
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.87
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.87
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.87
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.87
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.87
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.86
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.86
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.86
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.86
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.86
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.86
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.86
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.86
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.86
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.86
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.86
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.86
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.86
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.86
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.86
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.86
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.86
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.86
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.86
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.86
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.86
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.85
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.85
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.85
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.85
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.85
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.85
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.85
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.84
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.84
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.84
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.84
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.84
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.83
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.83
PLN03224507 probable serine/threonine protein kinase; Provisio 99.83
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.83
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.83
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.82
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.81
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.81
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.81
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.81
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.81
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.81
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.8
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.8
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.79
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.78
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.78
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.77
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.76
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.76
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.76
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.75
KOG1167418 consensus Serine/threonine protein kinase of the C 99.73
KOG3653534 consensus Transforming growth factor beta/activin 99.7
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.7
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.68
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.68
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.68
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.67
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.67
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.66
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.64
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.63
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.62
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.62
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.61
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.6
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.6
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.6
KOG06061205 consensus Microtubule-associated serine/threonine 99.59
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.58
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.58
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.56
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.56
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.56
KOG1152772 consensus Signal transduction serine/threonine kin 99.56
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.54
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.53
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.53
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.52
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.51
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.49
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.47
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.47
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.39
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.37
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.37
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.35
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.32
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.3
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.22
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.2
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.2
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.18
PF1540989 PH_8: Pleckstrin homology domain 99.18
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.16
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.16
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.06
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.05
PRK12274218 serine/threonine protein kinase; Provisional 99.01
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 98.95
KOG1023484 consensus Natriuretic peptide receptor, guanylate 98.91
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.85
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.8
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 98.79
PRK09188365 serine/threonine protein kinase; Provisional 98.76
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.76
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 98.75
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.69
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 98.67
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.66
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.59
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 98.56
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 98.55
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.55
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.42
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.36
KOG2059 800 consensus Ras GTPase-activating protein [Signal tr 98.29
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.23
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.22
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 98.02
smart00090237 RIO RIO-like kinase. 97.85
KOG0690 516 consensus Serine/threonine protein kinase [Signal 97.79
PRK10345210 hypothetical protein; Provisional 97.79
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 97.72
COG4248 637 Uncharacterized protein with protein kinase and he 97.69
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 97.68
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 97.67
PRK14879211 serine/threonine protein kinase; Provisional 97.66
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 97.62
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 97.55
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 97.5
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 97.47
PRK09605535 bifunctional UGMP family protein/serine/threonine 97.44
KOG1266458 consensus Protein kinase [Signal transduction mech 97.42
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 97.24
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.08
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 97.05
KOG1243 690 consensus Protein kinase [General function predict 97.02
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 97.01
KOG3723851 consensus PH domain protein Melted [Signal transdu 97.0
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 96.72
PF15406112 PH_6: Pleckstrin homology domain 96.71
PLN02866 1068 phospholipase D 96.66
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 96.59
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 96.51
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 96.17
PF1447096 bPH_3: Bacterial PH domain 96.17
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 96.14
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 96.11
KOG0521 785 consensus Putative GTPase activating proteins (GAP 96.07
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 96.06
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 96.04
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 95.91
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 95.84
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.5e-72  Score=527.93  Aligned_cols=315  Identities=46%  Similarity=0.750  Sum_probs=263.0

Q ss_pred             CceEEcccCCCCEEEccCCcEEEeeCCCccccCCCcccccC---CCCCCCCccccccCCCCCchhhhCCCCCCCcchHHH
Q 020457            1 MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLP---NAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWA   77 (326)
Q Consensus         1 ~gIvHrDLKPeNILl~~~g~vkL~DFG~a~~~~~~~~~~~~---~~~~~~~~~~~~gt~~y~aPE~l~~~~~~~~sDvws   77 (326)
                      +|||||||||||||||++||+||+|||.|+.+.........   ......++.+||||+.|++||+|.+...+.++|+||
T Consensus       193 ~GIIHRDlKPENILLd~dmhikITDFGsAK~l~~~~~~~~~~~~~~~a~s~~~SFVGTAeYVSPElL~~~~~~~~sDiWA  272 (604)
T KOG0592|consen  193 NGIIHRDLKPENILLDKDGHIKITDFGSAKILSPSQKSQENPVDPNQASSRRSSFVGTAEYVSPELLNDSPAGPSSDLWA  272 (604)
T ss_pred             cCceeccCChhheeEcCCCcEEEeeccccccCChhhccccCccCcccccCcccceeeeecccCHHHhcCCCCCcccchHH
Confidence            59999999999999999999999999999999876544221   112334457899999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCCCCCCHHHHHHHHhhcccCCCCcCCHHHHHHHHHhhhcCCCCCCCCCCCcHHHHHcCCCCCCCCcc
Q 020457           78 LGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDWK  157 (326)
Q Consensus        78 lG~il~elltG~~Pf~~~~~~~~~~~i~~~~~~~p~~~~~~~~~Li~~~L~~dP~~R~s~~~~~~~~l~~hpff~~~~~~  157 (326)
                      ||||+|+|++|.+||.+.+++.+|++|+...+.||+++++.+++||+++|..||.+|+++     ++|++||||.+|+|+
T Consensus       273 lGCilyQmlaG~PPFra~NeyliFqkI~~l~y~fp~~fp~~a~dLv~KLLv~dp~~Rlt~-----~qIk~HpFF~~Vdw~  347 (604)
T KOG0592|consen  273 LGCILYQMLAGQPPFRAANEYLIFQKIQALDYEFPEGFPEDARDLIKKLLVRDPSDRLTS-----QQIKAHPFFEGVDWE  347 (604)
T ss_pred             HHHHHHHHhcCCCCCccccHHHHHHHHHHhcccCCCCCCHHHHHHHHHHHccCccccccH-----HHHhhCcccccCChh
Confidence            999999999999999999999999999999999999999999999999999999999998     789999999999999


Q ss_pred             cccCCCCCCCCCCCCcCCCCCCCCCCCCCCCCCCCCc-----------c--ccccC------------CCCCCCCCCCcc
Q 020457          158 NIRGQTPPKLASEPMVQSGEGDDVHDSSWNPSHIGDI-----------S--AKIND------------GNGGASSSEGSI  212 (326)
Q Consensus       158 ~l~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~--~~~~~------------~~~~~~~~~~~~  212 (326)
                      .|++++||.+.++.+..+.+.++.....+....++..           +  ...+.            .++.++......
T Consensus       348 nlw~~~PP~l~py~p~~~~s~e~~s~~~~~~~~~~~~~~~~~~~~~S~s~~~psn~~~~~~~~~~~~~~~~~~s~~~~~~  427 (604)
T KOG0592|consen  348 NLWQQTPPKLQPYKPATSISPEYYSAYTPLEPGLDERALFQVPSSASQSSALPSNVTHNGDKVAQPVAPSASSSESKNDT  427 (604)
T ss_pred             hhhhcCCCcccCCCCcccCCcccCcccccccCCccccccccccccccccccCCCcccccccchhhccccccccccCcchh
Confidence            9999999999999877766555433221111111100           0  00000            000001111112


Q ss_pred             ccccccc--ccccccccccCCCCeeEEeeceeecccceeeeeEEEeecCCcEEEEcCCCceEEEEEeccCCCCceEEEec
Q 020457          213 TRLASID--SFDSKWQQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVVKGNIIWSDNSNDLSIQVS  290 (326)
Q Consensus       213 ~~~~~~~--~~~~~~~~~~~~~e~i~~~g~~~K~~~~~~k~R~~ilt~~~~l~y~d~~~~~~kg~I~l~~~~~~~~~~~k  290 (326)
                      .|+.+.+  +.++.||+|+. ++.|++.|.|.|++|+|.|||+|+||++||++|+|+.++++||||||+++   +.++.+
T Consensus       428 ~R~q~le~~~~~~~w~~f~~-~~~i~k~~~l~k~~~lf~rkr~lllTn~~rll~~~~~~~~lk~eip~~~~---~~~e~~  503 (604)
T KOG0592|consen  428 ARLQSLESQSKDNPWHQFLE-GSLILKEGALEKRQGLFARKRMLLLTNGPRLLYVDPQNLVLKGEIPWSPD---LRVELK  503 (604)
T ss_pred             hhhhhccccccCccHHHhhh-hhhHHhHHHHHhhhhhhhceeEEEecCCCeEEEEecccceeccccccCcc---cceeec
Confidence            3344433  37788999996 99999999999999999999999999999999999999999999999996   899999


Q ss_pred             CCCcEEEEcCCceEEEEcCCccHHHHHHHHHHhc
Q 020457          291 SPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQ  324 (326)
Q Consensus       291 ~~~~f~i~t~~r~y~~~~~~~~~~~W~~~i~~~~  324 (326)
                      +.++|+|+||+|+|+|+|+++.|..|+++|+++.
T Consensus       504 n~~~~~i~TP~k~~~l~d~~~~as~w~~ai~~~~  537 (604)
T KOG0592|consen  504 NSSTFFIHTPNKVYYLEDPEQRASVWCKAIETVR  537 (604)
T ss_pred             cCcceEEECCccceeccCcccchhHHHHhhhhhh
Confidence            9999999999999999999999999999999874



>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PF14470 bPH_3: Bacterial PH domain Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 2e-35
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 4e-35
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 5e-35
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 5e-35
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 5e-35
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 5e-35
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 6e-35
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 6e-35
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 7e-35
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 7e-35
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-35
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 7e-35
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 8e-35
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 8e-35
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 9e-35
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 9e-35
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 1e-34
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-34
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-34
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 3e-33
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 3e-33
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-24
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-24
3g51_A325 Structural Diversity Of The Active Conformation Of 1e-24
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-23
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 3e-23
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 3e-23
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 3e-23
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 3e-23
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 4e-23
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 5e-23
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 2e-22
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 1e-21
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 1e-21
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 1e-21
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 2e-21
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 2e-21
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 2e-21
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 4e-21
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 4e-21
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 5e-21
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 6e-21
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 6e-21
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 7e-21
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 7e-21
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-20
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 3e-20
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 3e-20
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 1e-19
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 1e-19
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-19
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 4e-19
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 5e-19
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-18
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 2e-18
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 2e-18
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 2e-18
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 6e-18
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 8e-18
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 1e-17
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 1e-17
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 1e-17
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 1e-17
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-17
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-17
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-17
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 2e-17
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 2e-17
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 3e-17
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 3e-17
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-17
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-17
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 6e-17
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 6e-17
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 6e-17
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 6e-17
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 6e-17
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 6e-17
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 7e-17
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 7e-17
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 7e-17
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 7e-17
2qcs_A350 A Complex Structure Between The Catalytic And Regul 7e-17
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 7e-17
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 7e-17
4ae6_A343 Structure And Function Of The Human Sperm-specific 7e-17
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 7e-17
4ae9_A343 Structure And Function Of The Human Sperm-specific 7e-17
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 7e-17
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 7e-17
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 7e-17
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-17
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 7e-17
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-17
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 8e-17
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 8e-17
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 8e-17
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-17
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 8e-17
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 8e-17
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 8e-17
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 9e-17
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 9e-17
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 1e-16
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 1e-16
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 1e-16
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 1e-16
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 1e-16
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-16
1smh_A350 Protein Kinase A Variant Complex With Completely Or 1e-16
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 3e-16
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 4e-16
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 5e-16
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 6e-16
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 9e-16
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-15
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-15
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 1e-15
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-15
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-15
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-15
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-15
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 2e-15
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-15
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 2e-15
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 2e-15
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-15
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-15
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 2e-15
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 2e-15
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-15
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 3e-15
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-15
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 5e-15
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 5e-15
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 5e-15
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 5e-15
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 5e-15
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 6e-15
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 6e-15
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 6e-15
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 6e-15
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-15
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 7e-15
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 9e-15
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 9e-15
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-14
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 1e-14
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-14
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-14
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 1e-14
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-14
3cik_A689 Human Grk2 In Complex With Gbetagamma Subunits Leng 4e-14
3krw_A688 Human Grk2 In Complex With Gbetgamma Subunits And B 5e-14
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 5e-14
1omw_A689 Crystal Structure Of The Complex Between G Protein- 5e-14
3psc_A695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 5e-14
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 6e-14
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 8e-14
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 9e-14
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 9e-14
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 1e-13
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 1e-13
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 1e-13
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 1e-13
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 1e-13
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 1e-13
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-13
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 1e-13
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 1e-13
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 2e-13
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-13
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 3e-13
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 4e-13
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 5e-13
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 6e-13
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 7e-13
3soa_A444 Full-Length Human Camkii Length = 444 7e-13
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 8e-13
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-13
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 8e-13
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-12
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-12
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-12
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-12
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-12
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 3e-12
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 3e-12
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 3e-12
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 3e-12
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 3e-12
3kk8_A284 Camkii Substrate Complex A Length = 284 3e-12
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 3e-12
3kk9_A282 Camkii Substrate Complex B Length = 282 3e-12
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 5e-12
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 6e-12
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 6e-12
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 7e-12
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 7e-12
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 8e-12
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-12
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 9e-12
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 9e-12
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 9e-12
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-12
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 1e-11
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-11
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-11
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-11
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-11
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-11
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-11
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 2e-11
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 2e-11
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 2e-11
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-11
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 3e-11
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-11
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 3e-11
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-11
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 4e-11
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 4e-11
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 4e-11
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-11
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-11
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-11
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 7e-11
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 8e-11
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 8e-11
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 8e-11
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 9e-11
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-10
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 1e-10
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-10
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 1e-10
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 1e-10
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-10
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 1e-10
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 1e-10
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 2e-10
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-10
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 2e-10
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 2e-10
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-10
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 2e-10
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 2e-10
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 2e-10
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-10
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 2e-10
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 2e-10
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 2e-10
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-10
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 2e-10
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-10
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-10
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 2e-10
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 2e-10
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 3e-10
3a7f_A303 Human Mst3 Kinase Length = 303 3e-10
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-10
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 4e-10
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 4e-10
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 4e-10
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 4e-10
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 5e-10
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 5e-10
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 5e-10
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 5e-10
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 5e-10
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 5e-10
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 5e-10
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 5e-10
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 6e-10
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 7e-10
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 1e-09
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 1e-09
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 1e-09
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-09
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 1e-09
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-09
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 1e-09
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-09
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 1e-09
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 2e-09
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 2e-09
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-09
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 2e-09
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-09
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 2e-09
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-09
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 2e-09
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 2e-09
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-09
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-09
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 3e-09
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 3e-09
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-09
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 3e-09
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 3e-09
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 3e-09
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 3e-09
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 4e-09
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 4e-09
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-09
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 4e-09
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-09
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 5e-09
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 5e-09
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 6e-09
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 6e-09
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 6e-09
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 7e-09
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 7e-09
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 8e-09
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 8e-09
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 8e-09
4fie_A423 Full-Length Human Pak4 Length = 423 9e-09
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-08
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-08
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 1e-08
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-08
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 1e-08
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-08
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 1e-08
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 1e-08
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-08
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 1e-08
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-08
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 1e-08
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 1e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 1e-08
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 1e-08
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 1e-08
2oza_A356 Structure Of P38alpha Complex Length = 356 1e-08
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-08
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-08
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 1e-08
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 1e-08
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-08
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 1e-08
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 1e-08
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-08
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 1e-08
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 1e-08
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-08
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-08
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 1e-08
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 1e-08
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 2e-08
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 2e-08
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-08
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-08
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 2e-08
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 2e-08
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 2e-08
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 2e-08
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 2e-08
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 2e-08
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 2e-08
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 2e-08
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 2e-08
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 2e-08
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 2e-08
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 2e-08
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 2e-08
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 2e-08
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 2e-08
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 2e-08
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 2e-08
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 2e-08
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 2e-08
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-08
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 2e-08
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 2e-08
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 2e-08
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 2e-08
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 2e-08
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 2e-08
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 2e-08
2oza_B366 Structure Of P38alpha Complex Length = 366 2e-08
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 2e-08
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 2e-08
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 2e-08
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 2e-08
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-08
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-08
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 2e-08
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 2e-08
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 2e-08
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 2e-08
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 2e-08
3hec_A348 P38 In Complex With Imatinib Length = 348 2e-08
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 2e-08
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 2e-08
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 2e-08
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 2e-08
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-08
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 2e-08
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-08
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 2e-08
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 2e-08
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 2e-08
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-08
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 2e-08
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 2e-08
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 2e-08
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 2e-08
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 2e-08
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 2e-08
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 2e-08
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-08
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 2e-08
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 2e-08
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-08
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 2e-08
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 2e-08
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 2e-08
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 2e-08
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-08
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 3e-08
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 3e-08
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 3e-08
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 3e-08
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 3e-08
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 3e-08
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 3e-08
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 3e-08
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-08
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 3e-08
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 3e-08
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 3e-08
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 3e-08
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 3e-08
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 3e-08
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 3e-08
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 3e-08
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 3e-08
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 3e-08
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 3e-08
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 3e-08
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 3e-08
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-08
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 3e-08
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 3e-08
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 3e-08
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 3e-08
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 3e-08
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 3e-08
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 3e-08
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 3e-08
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 3e-08
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-08
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 3e-08
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 3e-08
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 3e-08
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 3e-08
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 4e-08
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 4e-08
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 4e-08
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 4e-08
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 4e-08
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 4e-08
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 4e-08
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 4e-08
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 4e-08
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 4e-08
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 4e-08
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 4e-08
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-08
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 4e-08
4fst_A269 Crystal Structure Of The Chk1 Length = 269 4e-08
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-08
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 4e-08
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 5e-08
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-08
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-08
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-08
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-08
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 5e-08
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 5e-08
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-08
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-08
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 5e-08
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 5e-08
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 5e-08
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-08
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 5e-08
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-08
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 5e-08
4exu_A371 Mapk13, Inactive Form Length = 371 5e-08
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-08
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 5e-08
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-08
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 5e-08
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 6e-08
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 6e-08
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 6e-08
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 6e-08
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 7e-08
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 7e-08
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 7e-08
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 8e-08
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 8e-08
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 8e-08
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 8e-08
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 9e-08
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 9e-08
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 1e-07
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 1e-07
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-07
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-07
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-07
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 1e-07
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-07
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 1e-07
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 1e-07
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-07
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 1e-07
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-07
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 1e-07
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 1e-07
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-07
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 1e-07
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 1e-07
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 1e-07
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 1e-07
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-07
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 1e-07
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 1e-07
4h58_A275 Braf In Complex With Compound 3 Length = 275 2e-07
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 2e-07
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 2e-07
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 2e-07
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 2e-07
1w1d_A151 Crystal Structure Of The Pdk1 Pleckstrin Homology ( 2e-07
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 2e-07
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-07
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 2e-07
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-07
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-07
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 2e-07
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-07
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-07
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 2e-07
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 2e-07
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 3e-07
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 3e-07
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-07
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 3e-07
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-07
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 3e-07
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 3e-07
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 3e-07
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 3e-07
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 3e-07
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 3e-07
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 3e-07
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 3e-07
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 3e-07
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 4e-07
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 4e-07
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-07
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 4e-07
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 4e-07
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 4e-07
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 5e-07
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 5e-07
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-07
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 5e-07
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 5e-07
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 5e-07
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-07
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 5e-07
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 5e-07
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 5e-07
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 5e-07
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 5e-07
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-07
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-07
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-07
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 5e-07
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 5e-07
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 5e-07
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 5e-07
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 5e-07
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 5e-07
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-07
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 5e-07
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-07
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 6e-07
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 6e-07
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 6e-07
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 6e-07
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 6e-07
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 6e-07
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 6e-07
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 6e-07
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 6e-07
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 6e-07
2vki_A148 Structure Of The Pdk1 Ph Domain K465e Mutant Length 6e-07
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 6e-07
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 6e-07
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 6e-07
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 7e-07
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 7e-07
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-07
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 7e-07
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 8e-07
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 8e-07
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 8e-07
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 8e-07
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 8e-07
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 9e-07
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 9e-07
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 9e-07
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 9e-07
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 9e-07
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 9e-07
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 9e-07
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 9e-07
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 9e-07
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 1e-06
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 1e-06
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 1e-06
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 1e-06
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-06
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 1e-06
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 1e-06
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 1e-06
4f99_A361 Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti 1e-06
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 1e-06
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 1e-06
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 1e-06
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 1e-06
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 1e-06
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 1e-06
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 1e-06
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 1e-06
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 1e-06
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 2e-06
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 2e-06
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 2e-06
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 2e-06
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 2e-06
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-06
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-06
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 3e-06
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 3e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 3e-06
3a4o_X286 Lyn Kinase Domain Length = 286 3e-06
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 3e-06
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 3e-06
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 3e-06
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-06
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 3e-06
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 3e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 4e-06
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 4e-06
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 5e-06
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 6e-06
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 6e-06
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 6e-06
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 6e-06
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 7e-06
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 8e-06
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 8e-06
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 9e-06
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 9e-06
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 9e-06
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 9e-06
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 1e-05
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 1e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 1e-05
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 1e-05
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 1e-05
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 1e-05
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 1e-05
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 1e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 1e-05
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 1e-05
2nry_A307 Crystal Structure Of Irak-4 Length = 307 1e-05
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 1e-05
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 1e-05
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 1e-05
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-05
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 1e-05
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-05
2nru_A307 Crystal Structure Of Irak-4 Length = 307 2e-05
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 2e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-05
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 2e-05
3lxn_A318 Structural And Thermodynamic Characterization Of Th 2e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 2e-05
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 2e-05
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-05
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-05
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-05
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 2e-05
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-05
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 2e-05
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 2e-05
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 2e-05
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 2e-05
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 2e-05
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 3e-05
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 3e-05
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 3e-05
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 3e-05
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 3e-05
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 3e-05
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-05
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-05
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 3e-05
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 3e-05
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 3e-05
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 3e-05
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 4e-05
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-05
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-05
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 4e-05
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 4e-05
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 5e-05
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 5e-05
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 5e-05
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 5e-05
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 5e-05
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 5e-05
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 5e-05
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 5e-05
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 5e-05
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 5e-05
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 5e-05
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 5e-05
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-05
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 5e-05
1rjb_A344 Crystal Structure Of Flt3 Length = 344 5e-05
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 5e-05
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 5e-05
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 5e-05
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 6e-05
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 6e-05
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 6e-05
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 6e-05
2pl0_A289 Lck Bound To Imatinib Length = 289 6e-05
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 6e-05
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 6e-05
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 6e-05
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 6e-05
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 6e-05
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 6e-05
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 7e-05
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 7e-05
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 7e-05
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 7e-05
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 7e-05
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 7e-05
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 7e-05
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 7e-05
2eu9_A355 Crystal Structure Of Clk3 Length = 355 8e-05
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 8e-05
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 8e-05
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 8e-05
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 8e-05
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 8e-05
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 9e-05
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 9e-05
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 9e-05
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 1e-04
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 1e-04
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 1e-04
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-04
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 1e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-04
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 1e-04
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 2e-04
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 2e-04
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-04
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 2e-04
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 2e-04
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 2e-04
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-04
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 2e-04
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 2e-04
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 2e-04
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 2e-04
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-04
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-04
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 3e-04
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-04
3uim_A326 Structural Basis For The Impact Of Phosphorylation 3e-04
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 3e-04
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 3e-04
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-04
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 3e-04
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-04
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 3e-04
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 3e-04
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-04
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 3e-04
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 3e-04
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 3e-04
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 3e-04
2g15_A318 Structural Characterization Of Autoinhibited C-Met 3e-04
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 3e-04
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 3e-04
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 3e-04
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-04
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 4e-04
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 4e-04
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 4e-04
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 4e-04
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 4e-04
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 4e-04
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 4e-04
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 4e-04
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 4e-04
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 4e-04
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 4e-04
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 4e-04
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 4e-04
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 4e-04
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 4e-04
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 4e-04
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 4e-04
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 4e-04
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 4e-04
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-04
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 5e-04
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 5e-04
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 5e-04
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 5e-04
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 5e-04
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 5e-04
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 5e-04
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 5e-04
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 5e-04
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 5e-04
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 5e-04
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 5e-04
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 5e-04
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 5e-04
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 5e-04
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 5e-04
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-04
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 5e-04
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-04
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-04
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 5e-04
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 5e-04
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 5e-04
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 5e-04
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 5e-04
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 6e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 6e-04
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 6e-04
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 6e-04
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-04
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 6e-04
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 6e-04
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 6e-04
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 6e-04
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 6e-04
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 6e-04
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 6e-04
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 6e-04
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 6e-04
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 6e-04
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 6e-04
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 7e-04
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 7e-04
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 8e-04
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 8e-04
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 8e-04
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 8e-04
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 9e-04
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 9e-04
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure

Iteration: 1

Score = 145 bits (367), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 73/169 (43%), Positives = 98/169 (57%), Gaps = 9/169 (5%) Query: 2 GLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPP 61 G+IHRD+KPEN+LL D HI+I DFG+ K VL + +A +FVGTA YV P Sbjct: 149 GIIHRDLKPENILLNEDMHIQITDFGTAK--------VLSPESKQARANSFVGTAQYVSP 200 Query: 62 EVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSXXXXX 121 E+L A +DLWALGC +YQ+++G PF+ +E+LIFQ+II + FP F Sbjct: 201 ELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARD 260 Query: 122 XXXXXXXXXPSGRPGAGP-GGYAVLKMHPFFKGIDWKNIRGQTPPKLAS 169 + R G GY LK HPFF+ + W+N+ QTPPKL + Sbjct: 261 LVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA 309
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|1W1D|A Chain A, Crystal Structure Of The Pdk1 Pleckstrin Homology (Ph) Domain Bound To Inositol (1,3,4,5)-Tetrakisphosphate Length = 151 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2VKI|A Chain A, Structure Of The Pdk1 Ph Domain K465e Mutant Length = 148 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|4F99|A Chain A, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide Length = 361 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-73
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 6e-57
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-55
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 4e-55
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 6e-55
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 4e-54
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 1e-53
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 3e-53
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 7e-53
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-52
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-52
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-52
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 2e-51
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-51
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 4e-51
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 3e-50
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 4e-50
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 6e-50
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 5e-49
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 6e-49
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 2e-48
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 5e-48
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-48
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 7e-48
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-46
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-45
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 7e-45
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-44
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 9e-44
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-43
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 4e-43
2a19_B284 Interferon-induced, double-stranded RNA-activated 4e-43
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-43
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 5e-41
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 1e-40
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 2e-40
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-40
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-39
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 2e-39
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 2e-39
3bhy_A283 Death-associated protein kinase 3; death associate 3e-39
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 5e-39
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 7e-39
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-37
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 1e-37
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-37
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 3e-37
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 4e-37
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 7e-37
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 9e-37
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-36
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-36
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-36
2y0a_A326 Death-associated protein kinase 1; transferase, ca 2e-36
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 3e-36
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 4e-36
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 6e-36
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-35
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-35
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 2e-35
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 4e-35
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 7e-35
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 9e-35
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-35
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-34
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-34
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-34
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 4e-34
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-34
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 4e-34
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 5e-34
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 5e-34
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-33
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 1e-33
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-33
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-33
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-33
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-33
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-33
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-33
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 3e-33
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-33
2eue_A275 Carbon catabolite derepressing protein kinase; kin 4e-33
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 4e-33
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 5e-33
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 1e-32
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-32
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-32
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 1e-31
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-31
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-31
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 7e-30
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 7e-30
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 5e-29
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-28
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 3e-28
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-27
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-26
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-26
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-26
2dyl_A318 Dual specificity mitogen-activated protein kinase 5e-25
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 8e-25
3fme_A290 Dual specificity mitogen-activated protein kinase; 1e-24
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-24
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 6e-24
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-23
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-23
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-23
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-23
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 9e-23
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-22
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-22
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-21
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-21
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 2e-21
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-21
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-21
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 5e-21
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 5e-21
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 6e-21
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-20
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 8e-20
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 9e-20
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 1e-19
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 2e-19
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 3e-19
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 4e-19
3niz_A311 Rhodanese family protein; structural genomics, str 5e-19
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 5e-19
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 8e-19
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 1e-18
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-18
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-18
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-18
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-18
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 3e-18
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 5e-18
3uqc_A286 Probable conserved transmembrane protein; structur 7e-18
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 9e-18
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 1e-17
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-17
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 2e-17
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-17
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-17
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 3e-17
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 6e-17
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 7e-17
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-17
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 8e-17
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 1e-16
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-16
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 1e-16
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 2e-16
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 4e-16
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 5e-16
3q4u_A301 Activin receptor type-1; structural genomics conso 6e-16
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-15
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 3e-15
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 5e-15
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-15
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-14
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 2e-14
3rp9_A458 Mitogen-activated protein kinase; structural genom 3e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 4e-14
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 1e-13
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-13
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 5e-13
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 7e-13
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-11
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 3e-10
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 3e-10
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-09
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 3e-09
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 1e-08
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 3e-08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-07
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-07
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-07
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 6e-07
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 6e-07
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 7e-07
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 9e-07
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-06
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-06
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-06
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 2e-06
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-06
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-06
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-06
3poz_A327 Epidermal growth factor receptor; kinase domain, a 2e-06
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-06
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-06
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 3e-06
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 4e-06
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 6e-06
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 6e-06
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 8e-06
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-06
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 1e-05
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 1e-05
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-05
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 4e-05
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 4e-05
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 9e-05
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 9e-05
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 1e-04
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 2e-04
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-04
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-04
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-04
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 6e-04
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 6e-04
3pls_A298 Macrophage-stimulating protein receptor; protein k 7e-04
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
 Score =  229 bits (585), Expect = 1e-73
 Identities = 80/170 (47%), Positives = 109/170 (64%), Gaps = 9/170 (5%)

Query: 1   MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 60
            G+IHRD+KPEN+LL  D HI+I DFG+ K        VL   +   +A +FVGTA YV 
Sbjct: 149 KGIIHRDLKPENILLNEDMHIQITDFGTAK--------VLSPESKQARANSFVGTAQYVS 200

Query: 61  PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAAR 120
           PE+L    A   +DLWALGC +YQ+++G  PF+  +E+LIFQ+II  +  FP  F   AR
Sbjct: 201 PELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKAR 260

Query: 121 DLIDRLLDVDPSGRPGAGP-GGYAVLKMHPFFKGIDWKNIRGQTPPKLAS 169
           DL+++LL +D + R G     GY  LK HPFF+ + W+N+  QTPPKL +
Sbjct: 261 DLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA 310


>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Length = 151 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.98
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.98
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.98
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.98
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.98
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.97
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.97
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.97
4aoj_A329 High affinity nerve growth factor receptor; transf 99.97
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.97
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.97
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.97
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.97
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.97
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.97
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.96
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.96
3niz_A311 Rhodanese family protein; structural genomics, str 99.96
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.96
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.96
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.96
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.96
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.96
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.96
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.96
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.96
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.96
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.96
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.96
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.96
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.96
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.96
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.96
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.96
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.95
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.95
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.95
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.95
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.95
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.95
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.95
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.95
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.95
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.95
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.95
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.95
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.95
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.95
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.95
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.95
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.95
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.95
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.95
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.95
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.95
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.95
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.95
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.95
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.95
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.95
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.95
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.95
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.95
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.95
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.95
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.95
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.95
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.95
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.95
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.95
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.95
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.95
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.95
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.95
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.95
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.95
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.95
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.95
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.95
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.95
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.95
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.95
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.95
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.95
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.95
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.94
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.94
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.94
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.94
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.94
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.94
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.94
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.94
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.94
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.94
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.94
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.94
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.94
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.94
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.94
3bhy_A283 Death-associated protein kinase 3; death associate 99.94
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.94
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.94
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.94
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.94
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.94
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.94
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.94
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.94
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.94
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.94
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.94
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.94
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.94
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.94
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.94
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.93
3ork_A311 Serine/threonine protein kinase; structural genomi 99.93
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.93
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.93
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.93
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.93
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.93
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.93
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.93
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.93
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.93
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.93
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.93
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.93
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.93
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.93
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.93
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.93
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.93
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.93
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.93
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.93
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.93
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.93
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.93
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.92
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.92
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.92
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.92
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.92
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.92
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.92
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.92
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.92
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.92
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.92
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.92
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.92
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.92
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.92
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.92
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.92
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.92
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.91
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.91
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.91
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.91
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.91
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.91
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.91
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.91
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.91
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.91
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.91
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.91
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.91
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.91
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.91
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.91
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.91
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.91
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.91
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.91
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
3soc_A322 Activin receptor type-2A; structural genomics cons 99.91
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.91
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.91
3q4u_A301 Activin receptor type-1; structural genomics conso 99.9
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.9
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.9
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.9
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.9
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.9
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.9
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.9
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.9
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.9
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.9
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.9
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.9
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.9
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.9
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.9
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.9
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.9
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.9
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.9
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.89
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.89
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.89
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.89
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.89
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.89
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.89
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.89
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.89
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.88
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.88
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.88
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.88
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.87
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.87
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.87
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.86
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.82
3uqc_A286 Probable conserved transmembrane protein; structur 99.72
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.65
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.63
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.63
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.63
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.6
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.6
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.59
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.58
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.58
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.58
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.58
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.57
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.57
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.57
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.56
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.56
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.55
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.55
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.54
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.54
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.54
1wi1_A126 Calcium-dependent activator protein for secretion, 99.53
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.52
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.52
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.52
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.52
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.51
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.51
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.5
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.5
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.5
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.5
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.49
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.49
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.49
2yry_A122 Pleckstrin homology domain-containing family A mem 99.49
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.48
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.48
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.47
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.46
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.45
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.45
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.42
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.42
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.4
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.38
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.38
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.38
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.31
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.31
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 99.3
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 99.25
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.25
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 99.21
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.18
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.18
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.16
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.16
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.12
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.12
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.05
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 98.97
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.92
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 98.89
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.82
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.71
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 98.69
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.51
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.33
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 98.25
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 98.25
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.95
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 97.92
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 97.54
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.45
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.41
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 97.24
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.18
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 97.13
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.07
3ml4_A 224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.01
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 96.87
3tfm_A 228 Myosin X; split PH domain, motor protein; 2.53A {R 96.85
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.62
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 96.61
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.61
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 96.54
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 96.48
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 96.41
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 96.39
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 96.36
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 96.16
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 95.78
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 95.77
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 95.72
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 95.57
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 95.48
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 95.37
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 95.37
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 95.35
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 95.23
2q83_A346 YTAA protein; 2635576, structural genomics, joint 95.15
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 95.08
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 95.01
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 94.33
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 94.32
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 93.7
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 93.48
3r70_A320 Aminoglycoside phosphotransferase; structural geno 93.29
1foe_A377 T-lymphoma invasion and metastasis inducing protei 93.04
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 92.96
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 92.76
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 92.6
3ats_A357 Putative uncharacterized protein; hypothetical pro 92.2
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 91.46
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 91.34
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 90.45
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 90.37
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 89.3
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 88.97
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 88.53
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 87.63
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 86.88
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 86.53
3ulb_A121 Target of rapamycin complex 2 subunit AVO1; PH dom 85.86
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 84.35
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 83.69
3mes_A424 Choline kinase; malaria, structural genomics, stru 81.57
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
Probab=100.00  E-value=1.9e-49  Score=398.11  Aligned_cols=299  Identities=24%  Similarity=0.396  Sum_probs=213.3

Q ss_pred             CceEEcccCCCCEEEccCCcEEEeeCCCccccCCCcccccCCCCCCCCccccccCCCCCchhhhC-CCCCCCcchHHHHH
Q 020457            1 MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLN-SSPATFGNDLWALG   79 (326)
Q Consensus         1 ~gIvHrDLKPeNILl~~~g~vkL~DFG~a~~~~~~~~~~~~~~~~~~~~~~~~gt~~y~aPE~l~-~~~~~~~sDvwslG   79 (326)
                      +|||||||||+||||+.+|+|||+|||+|+.+..            ....++|||+.|||||++. +..|+.++||||||
T Consensus       311 ~gIiHRDLKPeNILld~~G~vKL~DFGlA~~~~~------------~~~~t~~GTp~YmAPEvl~~~~~y~~~vDiWSLG  378 (689)
T 3v5w_A          311 RFVVYRDLKPANILLDEHGHVRISDLGLACDFSK------------KKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLG  378 (689)
T ss_dssp             TTEECCCCSGGGEEECTTSCEEECCCTTCEECSS------------CCCCSCCSCGGGCCHHHHSTTCCCCTHHHHHHHH
T ss_pred             CCccccCCchHHeEEeCCCCEEecccceeeecCC------------CCCCCccCCcCccCHHHHhCCCCCCcHHHHHHHH
Confidence            5999999999999999999999999999987643            2345789999999999996 46799999999999


Q ss_pred             HHHHHHHcCCCCCCCC---CHHHHHHHHhhcccCCCCcCCHHHHHHHHHhhhcCCCCCCCCCCCcHHHHHcCCCCCCCCc
Q 020457           80 CTLYQMLSGTSPFKDT---SEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGPGGYAVLKMHPFFKGIDW  156 (326)
Q Consensus        80 ~il~elltG~~Pf~~~---~~~~~~~~i~~~~~~~p~~~~~~~~~Li~~~L~~dP~~R~s~~~~~~~~l~~hpff~~~~~  156 (326)
                      |++|+|++|.+||.+.   +...+...+....+.+|..+++++++||.+||..||.+|+++...+++++++||||++++|
T Consensus       379 vilYEmLtG~~PF~~~~~~~~~~i~~~i~~~~~~~p~~~S~~a~dLI~~lL~~dP~~Rl~~~~~ga~ei~~HpfF~~idW  458 (689)
T 3v5w_A          379 CMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDW  458 (689)
T ss_dssp             HHHHHHHHSSCTTCGGGCCCHHHHHHHHHHCCCCCCTTSCHHHHHHHHHHTCSCGGGCTTCSSSTHHHHTTSGGGTTCCH
T ss_pred             HHHHHHHhCCCCCCCCChHHHHHHHHhhcCCCCCCCccCCHHHHHHHHHHccCCHhHCCCCCCCCHHHHhcCccccCCCH
Confidence            9999999999999763   4567788888899999999999999999999999999999987778999999999999999


Q ss_pred             ccccCCC-CCCCCCCCCcCCCCCCCCCCCCCCC-----CCCCCccccccCCCCC-CCC------CCCccc-------ccc
Q 020457          157 KNIRGQT-PPKLASEPMVQSGEGDDVHDSSWNP-----SHIGDISAKINDGNGG-ASS------SEGSIT-------RLA  216 (326)
Q Consensus       157 ~~l~~~~-~p~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~-~~~------~~~~~~-------~~~  216 (326)
                      +.|..+. +|++.|........ +....+.++.     ..+.+.....-.+.+. .++      .+....       ++.
T Consensus       459 ~~l~~~~~~pP~~P~~~~~~~~-~~fD~~~fd~e~~~~~~~~~~d~~~f~~Fs~~~~~~~q~e~~et~~~~~n~~~~~~~  537 (689)
T 3v5w_A          459 QMVFLQKYPPPLIPPRGEVNAA-DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLE  537 (689)
T ss_dssp             HHHHTTCSCCSCCCCTTCSSTT-BCCC---------CCCCCCHHHHTTTTTCCEECHHHHHHHHHTTTHHHHHHHHHHHH
T ss_pred             HHHHcCCCCcCccCCCCCCCcC-CCCCCccCCccccCCCCCCchHHHHHhCCCccCccchhhhhhhhhhhhhccchhhHH
Confidence            9997653 45454433221110 0000011111     0000000000000000 000      000000       000


Q ss_pred             cc----cccccccccccCCCCeeEEeeceeecccce---eeeeEEEe-----------ecCCcEEEEcCCCceEEEEEec
Q 020457          217 SI----DSFDSKWQQFLDPGESVLMISMVKKLQKLT---SKKVQLIL-----------TNKPKLIYVDPSKLVVKGNIIW  278 (326)
Q Consensus       217 ~~----~~~~~~~~~~~~~~e~i~~~g~~~K~~~~~---~k~R~~il-----------t~~~~l~y~d~~~~~~kg~I~l  278 (326)
                      ..    ........++. .|+.+++.|++.|++|.+   |++|+|.|           +..++|+|.++..+..||+|+|
T Consensus       538 ~~~~~~~~~~~~~~~~~-~~~~~i~~G~~~k~~g~f~~~~~rR~~~l~p~r~e~~~e~~~~~~l~~~~~v~~v~k~~i~~  616 (689)
T 3v5w_A          538 ARKKAKNKQLGHEEDYA-LGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKE  616 (689)
T ss_dssp             HHHHHHHHHTSCCSCTT-SSSCCCEEEEEEEC-------CEEEEEEEETTEEEEECTTSCCCEEEEGGGEEEEEEEESSS
T ss_pred             HhHHHhhhhhccccccc-cCCcceeecccccCCCcccchhhhhccccCCCcccccccCCCCcceeeeccccccccCcCCC
Confidence            00    00011122343 588899999999999964   79999998           3355678888888899999999


Q ss_pred             cCCCCceEEEecCCCcEEEEcCCceEEEEcCCccHHHHHHHHHHhc
Q 020457          279 SDNSNDLSIQVSSPSHFKIVTPKKVLSFEDAKQRASQWKKAIEALQ  324 (326)
Q Consensus       279 ~~~~~~~~~~~k~~~~f~i~t~~r~y~~~~~~~~~~~W~~~i~~~~  324 (326)
                      +++   +.++.|+.+.|.|+||+        +.++.+|+++|.++.
T Consensus       617 ~~~---l~~~~k~~k~f~~~t~~--------~~~~~~W~~~i~~~~  651 (689)
T 3v5w_A          617 RKC---LLLKIRGGKQFILQCDS--------DPELVQWKKELRDAY  651 (689)
T ss_dssp             CEE---EEEEETTTEEEEEECSS--------HHHHHHHHHHHHHHH
T ss_pred             Ccc---eeeeecCCcEEEEECCC--------hHHHHHHHHHHHHHH
Confidence            987   89999999999999987        236899999998753



>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3ulb_A Target of rapamycin complex 2 subunit AVO1; PH domain, membrane localization, membrane protein; 1.90A {Saccharomyces cerevisiae} PDB: 3ulc_A Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 326
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 3e-52
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 7e-48
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-44
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-43
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-42
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-39
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-39
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 7e-39
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-37
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-37
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-37
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 7e-37
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-36
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-36
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 8e-36
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-35
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-35
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-35
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-34
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 7e-34
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-33
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-33
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-32
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-31
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-30
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-30
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-29
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-29
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 9e-29
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-28
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 4e-28
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-27
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-27
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 4e-27
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 9e-27
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-26
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-26
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-26
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-26
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-26
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-26
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-26
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 7e-26
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-25
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-25
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-25
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-25
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-25
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-24
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-24
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 5e-24
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-23
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-23
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-23
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-23
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-22
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-22
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-21
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-20
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 3e-20
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-20
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-19
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 2e-16
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-04
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  171 bits (435), Expect = 3e-52
 Identities = 78/170 (45%), Positives = 107/170 (62%), Gaps = 9/170 (5%)

Query: 1   MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVP 60
            G+IHRD+KPEN+LL  D HI+I DFG+ K +               +A +FVGTA YV 
Sbjct: 127 KGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPES--------KQARANSFVGTAQYVS 178

Query: 61  PEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAAR 120
           PE+L    A   +DLWALGC +YQ+++G  PF+  +E+LIFQ+II  +  FP  F   AR
Sbjct: 179 PELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKAR 238

Query: 121 DLIDRLLDVDPSGRPGAG-PGGYAVLKMHPFFKGIDWKNIRGQTPPKLAS 169
           DL+++LL +D + R G     GY  LK HPFF+ + W+N+  QTPPKL +
Sbjct: 239 DLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA 288


>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.98
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.98
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.97
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.97
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.97
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.97
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.97
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.97
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.96
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.96
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.96
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.96
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.96
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.96
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.96
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.96
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.96
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.96
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.96
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.96
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.96
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.96
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.95
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.95
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.95
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.95
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.95
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.94
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.94
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.94
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.94
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.93
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.93
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.68
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.63
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.6
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.48
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.44
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.44
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.42
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.41
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.41
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.4
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.4
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.39
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.39
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.36
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.35
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.34
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.33
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.33
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.31
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.29
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.28
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.2
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.17
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 98.97
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 98.91
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.81
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 98.77
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.47
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.37
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.21
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.06
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.03
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.43
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.35
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 97.3
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 96.68
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 96.42
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.08
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.04
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 93.07
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 92.62
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 90.65
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 90.27
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.4e-41  Score=307.39  Aligned_cols=160  Identities=49%  Similarity=0.923  Sum_probs=141.7

Q ss_pred             CceEEcccCCCCEEEccCCcEEEeeCCCccccCCCcccccCCCCCCCCccccccCCCCCchhhhCCCCCCCcchHHHHHH
Q 020457            1 MGLIHRDIKPENLLLTADGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGC   80 (326)
Q Consensus         1 ~gIvHrDLKPeNILl~~~g~vkL~DFG~a~~~~~~~~~~~~~~~~~~~~~~~~gt~~y~aPE~l~~~~~~~~sDvwslG~   80 (326)
                      +|||||||||+|||++++|++||+|||+|+.+....        ......+.+||+.|+|||++.+..++.++|||||||
T Consensus       127 ~~iiHrDiKp~NIll~~~~~vkl~DFG~a~~~~~~~--------~~~~~~~~~GT~~Y~APE~~~~~~~~~~~DiwSlGv  198 (288)
T d1uu3a_         127 KGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPES--------KQARANSFVGTAQYVSPELLTEKSACKSSDLWALGC  198 (288)
T ss_dssp             TTEECSCCSGGGEEECTTSCEEECCCTTCEECC------------------CCCCGGGCCHHHHHTCCCCHHHHHHHHHH
T ss_pred             ccEEcCcCCccccccCCCceEEecccccceecccCC--------cccccccccCCccccCceeeccCCCCcccceehhhH
Confidence            589999999999999999999999999999765321        123344678999999999999999999999999999


Q ss_pred             HHHHHHcCCCCCCCCCHHHHHHHHhhcccCCCCcCCHHHHHHHHHhhhcCCCCCCCCCC-CcHHHHHcCCCCCCCCcccc
Q 020457           81 TLYQMLSGTSPFKDTSEWLIFQRIIARDIRFPNYFSDAARDLIDRLLDVDPSGRPGAGP-GGYAVLKMHPFFKGIDWKNI  159 (326)
Q Consensus        81 il~elltG~~Pf~~~~~~~~~~~i~~~~~~~p~~~~~~~~~Li~~~L~~dP~~R~s~~~-~~~~~l~~hpff~~~~~~~l  159 (326)
                      ++|+|++|..||.+.+...++.++....+.+|..+++++++||.+||+.||++|||+.+ .....+++||||++++|+.|
T Consensus       199 ilyell~g~~Pf~~~~~~~~~~~i~~~~~~~p~~~s~~~~~li~~~L~~dP~~R~t~~e~~~~~~i~~Hpff~~i~w~~l  278 (288)
T d1uu3a_         199 IIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL  278 (288)
T ss_dssp             HHHHHHHSSCSSCCSSHHHHHHHHHTTCCCCCTTCCHHHHHHHHTTSCSSGGGSTTSGGGTCHHHHHTSGGGTTCCCTTG
T ss_pred             HHHHHhhCCCCCCCcCHHHHHHHHHcCCCCCCccCCHHHHHHHHHHccCCHhHCcCHHHHcCCHHHHcCCccCCCCHHHh
Confidence            99999999999999999999999999999999999999999999999999999999976 45677999999999999999


Q ss_pred             cCCCCCCCC
Q 020457          160 RGQTPPKLA  168 (326)
Q Consensus       160 ~~~~~p~~~  168 (326)
                      ..++||+++
T Consensus       279 ~~~~pP~l~  287 (288)
T d1uu3a_         279 HQQTPPKLT  287 (288)
T ss_dssp             GGSCCCCCC
T ss_pred             hcCCCCCCC
Confidence            999888764



>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure