BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020497
(325 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase
pdb|3M0J|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
The Inhibitor 3,3-Difluorooxalacetate
pdb|3M0K|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
The Product Oxalate
Length = 307
Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
Query: 73 EKGSEPLITVEALHQL--HILIFFLAVFHVLYSAITMMLGRLKIRG 116
E G PLITVE + I+IF A Y+AI L RL+ G
Sbjct: 224 ENGHSPLITVEEAKAMGFRIMIFSFATLAPAYAAIRETLVRLRDHG 269
>pdb|1J0A|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0A|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0A|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
pdb|1J0B|A Chain A, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|B Chain B, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|C Chain C, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|D Chain D, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|E Chain E, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|F Chain F, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|G Chain G, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|H Chain H, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|I Chain I, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|J Chain J, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|K Chain K, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|L Chain L, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|M Chain M, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|N Chain N, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|O Chain O, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|P Chain P, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|Q Chain Q, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|R Chain R, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|S Chain S, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|T Chain T, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|U Chain U, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|V Chain V, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|W Chain W, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
pdb|1J0B|X Chain X, Crystal Structure Analysis Of The Acc Deaminase Homologue
Complexed With Inhiitor
Length = 325
Score = 28.5 bits (62), Expect = 4.9, Method: Compositional matrix adjust.
Identities = 14/43 (32%), Positives = 26/43 (60%)
Query: 74 KGSEPLITVEALHQLHILIFFLAVFHVLYSAITMMLGRLKIRG 116
KG++ +ITV A+H H + LA + AI ++ G+ +++G
Sbjct: 68 KGADVVITVGAVHSNHAFVTGLAAKKLGLDAILVLRGKEELKG 110
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.141 0.450
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,119,658
Number of Sequences: 62578
Number of extensions: 347570
Number of successful extensions: 723
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 722
Number of HSP's gapped (non-prelim): 5
length of query: 325
length of database: 14,973,337
effective HSP length: 99
effective length of query: 226
effective length of database: 8,778,115
effective search space: 1983853990
effective search space used: 1983853990
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)