BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020534
(325 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1W7N|A Chain A, Crystal Structure Of Human Kynurenine Aminotransferase I
In Pmp Form
Length = 422
Score = 39.3 bits (90), Expect = 0.003, Method: Compositional matrix adjust.
Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)
Query: 175 IEEWMEKEDRKQLDIQSLVSELERNFTVSKETCFCGKVFGALLSKLALVLGPDANLKE 232
+ +WM + + + I SL ER T+ GK F A K+ VLGPD +K
Sbjct: 215 VYQWMVYDGHQHISIASLPGMWERTLTIGS----AGKTFSATGWKVGWVLGPDHIMKH 268
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.130 0.352
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,947,566
Number of Sequences: 62578
Number of extensions: 212514
Number of successful extensions: 594
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 585
Number of HSP's gapped (non-prelim): 17
length of query: 325
length of database: 14,973,337
effective HSP length: 99
effective length of query: 226
effective length of database: 8,778,115
effective search space: 1983853990
effective search space used: 1983853990
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)