Query         020539
Match_columns 325
No_of_seqs    125 out of 142
Neff          4.2 
Searched_HMMs 46136
Date          Fri Mar 29 03:12:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020539.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/020539hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR03602 streptolysinS bacter  59.8     3.3 7.2E-05   31.2   0.3   10  316-325    26-35  (56)
  2 PF06814 Lung_7-TM_R:  Lung sev  44.9 1.3E+02  0.0029   28.6   8.6  120   83-225    46-166 (295)
  3 KOG4628 Predicted E3 ubiquitin  39.6      38 0.00083   34.3   4.1   41  241-281   184-226 (348)
  4 PF01456 Mucin:  Mucin-like gly  38.6      13 0.00028   31.6   0.6   11  236-247     9-19  (143)
  5 PF04505 Dispanin:  Interferon-  37.7      20 0.00043   28.7   1.5   17  240-256    25-42  (82)
  6 PF02326 YMF19:  Plant ATP synt  29.4      28  0.0006   28.3   1.1   33  211-257    10-42  (86)
  7 COG3671 Predicted membrane pro  27.7 1.1E+02  0.0023   27.0   4.4   45  214-258    70-114 (125)
  8 PF02656 DUF202:  Domain of unk  25.3      99  0.0021   23.3   3.4   45   92-136    17-64  (73)
  9 PF03839 Sec62:  Translocation   24.7 2.2E+02  0.0047   27.2   6.3   17  184-200   161-180 (224)
 10 KOG1341 Na+/K+ transporter [In  21.5      92   0.002   34.4   3.4   29  173-201   456-488 (854)
 11 PF11712 Vma12:  Endoplasmic re  21.5 1.4E+02  0.0031   25.7   4.1   26  173-198    79-104 (142)
 12 KOG2927 Membrane component of   20.9 2.5E+02  0.0054   28.9   6.1   16  185-200   241-259 (372)
 13 PF12751 Vac7:  Vacuolar segreg  20.5 1.3E+02  0.0029   31.0   4.2   34   75-108   296-329 (387)

No 1  
>TIGR03602 streptolysinS bacteriocin protoxin, streptolysin S family. Members of this family are bacteriocin precursors. These small, ribosomally produced polypeptide precursors are extensively processed post-translationally. This family belongs to a class of heterocycle-containing bacteriocins, including streptolysin S from Streptococcus pyogenes, and related bacteriocins from Streptococcus iniae and Clostridium botulinum. Streptolysin S is hemolytic. Bacteriocin genes in general are small and highly diverse, with odd sequence composition, and are easily missed by many gene-finding programs.
Probab=59.80  E-value=3.3  Score=31.17  Aligned_cols=10  Identities=40%  Similarity=1.238  Sum_probs=5.9

Q ss_pred             ceeeeecccC
Q 020539          316 SLSLCCVLCF  325 (325)
Q Consensus       316 CCi~~~~~~~  325 (325)
                      ||.|||+-||
T Consensus        26 cccccc~cc~   35 (56)
T TIGR03602        26 CCCCCCCCCF   35 (56)
T ss_pred             eEEEeccEEE
Confidence            6666665554


No 2  
>PF06814 Lung_7-TM_R:  Lung seven transmembrane receptor;  InterPro: IPR009637 This family represents a conserved region with eukaryotic lung seven transmembrane receptors and related proteins.; GO: 0016021 integral to membrane
Probab=44.94  E-value=1.3e+02  Score=28.57  Aligned_cols=120  Identities=11%  Similarity=0.114  Sum_probs=74.4

Q ss_pred             cchhhHHHHHHHHHHHHHhhhhcc-cCCCCCCchhhhhhhhhhhhhhHHhhhhhhhhhcccCCCccccCCCCCCCCCCCC
Q 020539           83 PIIVLDVLWNLVFVIVAFAVLGVS-INEKPEVPLRLRIVGYALQCLFHVFCVSLEFKRRRRGEGVVFGDSVSGSSSTTVT  161 (325)
Q Consensus        83 pwi~lelvwnlaqIvaaivVL~lS-k~E~P~~PLr~WIvGYa~gCv~~l~lv~~rYr~rn~~~~~~~~~~~~~~~~~s~~  161 (325)
                      |-..+-.+..++..+.++.-+... ++-+.-.|+.-||.+..+-..+.+.+.+..|...|.......             
T Consensus        46 pl~~~y~~~~i~y~~~~~~W~~~~~~~~~~~~~ih~~i~~vl~l~~~~~~~~~~~y~~~n~~G~~~~-------------  112 (295)
T PF06814_consen   46 PLPPFYGVMSIVYAVLLIIWLFLCFKNRKSVLPIHYLILAVLILKMLELAFWFIYYHYINKTGTPSE-------------  112 (295)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCCc-------------
Confidence            445566777777777777766666 455667899999999999888999998888888776431100             


Q ss_pred             CcccccccCCcchHHHHHhHHHHHHHHHHHhhhheeeeecCCCcccCCCCchhhhhHHHhhhch
Q 020539          162 GDEEERFHGENDSSVAKNLESANTFLSFLWWIVGFYWITASGETLISCSPQLYWLCVTFLAFDV  225 (325)
Q Consensus       162 ~~~~~~~~~~~~~~l~k~le~~lt~Ff~VWfVVGf~WV~~gg~ss~~dAP~LYwLCivFLAF~~  225 (325)
                             ....-..+...+|.++  ++++=.++|--|-+. ...+.+.--+.-.+-+.+..++.
T Consensus       113 -------~~~~~~~i~~~~k~~~--~~~llllis~Gygiv-kp~L~~~~~~v~~l~i~~~v~~~  166 (295)
T PF06814_consen  113 -------GWMIFAYIFSALKRTL--SFFLLLLISLGYGIV-KPSLGRREKKVLMLVILYFVFSN  166 (295)
T ss_pred             -------hHHHHHHHHHHHHHHH--HHHHHHHHhcchhee-ccccCcceeehhHHHHHHHHHHH
Confidence                   0012356666666444  444446777778662 34443333334444444444443


No 3  
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=39.60  E-value=38  Score=34.27  Aligned_cols=41  Identities=20%  Similarity=0.297  Sum_probs=30.3

Q ss_pred             hhhhhhhHHHHHHhhhh--ccCCCCHHHhhcCCCcceeecCCc
Q 020539          241 AVCCCLPCILGILYALT--EREGATEEEIDRLPKFKFSRIDGL  281 (325)
Q Consensus       241 alCCCLPCIIaiLya~~--d~eGAS~e~I~~LP~yKFk~~~~~  281 (325)
                      +.|+...-+....++..  +.+...++.+.+||.++|+..++.
T Consensus       184 ~~~f~i~~~~~~~~~r~~~~~~r~~k~~l~~~p~~~f~~~~~~  226 (348)
T KOG4628|consen  184 VTCFFIYRIRRLIRARNRLRRNRLIKRLLKKLPVRTFTKGDDE  226 (348)
T ss_pred             HHHHHHHHHHHHHHHHhHhhhhhhHHHHHhhCCcEEecccccc
Confidence            45566665666565554  467999999999999999976544


No 4  
>PF01456 Mucin:  Mucin-like glycoprotein;  InterPro: IPR000458 This family of trypanosomal proteins resemble vertebrate mucins. The protein consists of three regions. The N and C terminii are conserved between all members of the family, whereas the central region is not well conserved and contains a large number of threonine residues which can be glycosylated []. Indirect evidence suggested that these genes might encode the core protein of parasite mucins, glycoproteins that were proposed to be involved in the interaction with, and invasion of, mammalian host cells.
Probab=38.62  E-value=13  Score=31.56  Aligned_cols=11  Identities=55%  Similarity=1.606  Sum_probs=8.7

Q ss_pred             Hhhhhhhhhhhh
Q 020539          236 CLIGIAVCCCLP  247 (325)
Q Consensus       236 cli~ialCCCLP  247 (325)
                      -|+.+||||| |
T Consensus         9 alLvlaLcCC-p   19 (143)
T PF01456_consen    9 ALLVLALCCC-P   19 (143)
T ss_pred             HHHHHHHHcC-c
Confidence            3777889999 5


No 5  
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=37.69  E-value=20  Score=28.66  Aligned_cols=17  Identities=41%  Similarity=1.163  Sum_probs=11.0

Q ss_pred             hhhhhhhhH-HHHHHhhh
Q 020539          240 IAVCCCLPC-ILGILYAL  256 (325)
Q Consensus       240 ialCCCLPC-IIaiLya~  256 (325)
                      ..+|||+|+ |+++.|+.
T Consensus        25 s~l~Cc~PlGi~Ai~~s~   42 (82)
T PF04505_consen   25 STLCCCWPLGIVAIVYSS   42 (82)
T ss_pred             HHHHHHhhHHHHHheech
Confidence            345899995 45555664


No 6  
>PF02326 YMF19:  Plant ATP synthase F0;  InterPro: IPR003319 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit 8 (or ymf19) found in the F0 complex of mitochondrial F-ATPases from plants and algae. This subunit is sometimes found in association and N-terminal to IPR009455 from INTERPRO, in higher plants. Subunit 8 differs in sequence between plants, Metazoa (IPR001421 from INTERPRO) and fungi (IPR009230 from INTERPRO) [, ]. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Probab=29.40  E-value=28  Score=28.28  Aligned_cols=33  Identities=33%  Similarity=0.567  Sum_probs=23.0

Q ss_pred             CchhhhhHHHhhhchhhhhhhHHhhHhhhhhhhhhhhHHHHHHhhhh
Q 020539          211 PQLYWLCVTFLAFDVVFVMICVGVACLIGIAVCCCLPCILGILYALT  257 (325)
Q Consensus       211 P~LYwLCivFLAF~~~fvvicyalpcli~ialCCCLPCIIaiLya~~  257 (325)
                      +|.+|+|+.|++|=.+   +           +-..||-|..+|-.+.
T Consensus        10 sQ~fW~~i~f~~~y~~---~-----------~~~~lP~i~~~lk~R~   42 (86)
T PF02326_consen   10 SQYFWLLIFFFFFYIF---L-----------VNFILPKISRILKLRS   42 (86)
T ss_pred             HHHHHHHHHHHHHHHH---H-----------HHHHHHHHHHHHHHHH
Confidence            5789999998765442   1           1366898888886554


No 7  
>COG3671 Predicted membrane protein [Function unknown]
Probab=27.70  E-value=1.1e+02  Score=27.05  Aligned_cols=45  Identities=20%  Similarity=0.541  Sum_probs=29.6

Q ss_pred             hhhhHHHhhhchhhhhhhHHhhHhhhhhhhhhhhHHHHHHhhhhc
Q 020539          214 YWLCVTFLAFDVVFVMICVGVACLIGIAVCCCLPCILGILYALTE  258 (325)
Q Consensus       214 YwLCivFLAF~~~fvvicyalpcli~ialCCCLPCIIaiLya~~d  258 (325)
                      ||+|+.+--.+.++..+..++..+....+=..+=+++.+.|-..+
T Consensus        70 Fw~~vl~~iIg~Llt~lgiGv~i~~AlgvW~i~Riv~G~~yl~~g  114 (125)
T COG3671          70 FWLAVLWWIIGLLLTFLGIGVVILVALGVWYIYRIVIGFKYLNEG  114 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            455555544455554555566666677777888888888887765


No 8  
>PF02656 DUF202:  Domain of unknown function (DUF202);  InterPro: IPR003807 This entry describes proteins of unknown function.
Probab=25.27  E-value=99  Score=23.33  Aligned_cols=45  Identities=20%  Similarity=0.131  Sum_probs=29.3

Q ss_pred             HHHHHHHHHhhhhcccCCCCCC---chhhhhhhhhhhhhhHHhhhhhh
Q 020539           92 NLVFVIVAFAVLGVSINEKPEV---PLRLRIVGYALQCLFHVFCVSLE  136 (325)
Q Consensus        92 nlaqIvaaivVL~lSk~E~P~~---PLr~WIvGYa~gCv~~l~lv~~r  136 (325)
                      .++.++++++++-.....++..   .--..++|+.+-.+..+.+++..
T Consensus        17 ~l~l~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   64 (73)
T PF02656_consen   17 ALALVGVGLALLRFFSLDHPSSSASRRVSKVLGLLLIVLGLLTLIYGI   64 (73)
T ss_pred             HHHHHHHHHHHHHhccccccccccchHHHHHHHHHHHHHHHHHHHHHH
Confidence            4667777777777776544321   33466888888887777776643


No 9  
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=24.74  E-value=2.2e+02  Score=27.20  Aligned_cols=17  Identities=18%  Similarity=0.747  Sum_probs=13.5

Q ss_pred             HHHHHHHHhhhh---eeeee
Q 020539          184 NTFLSFLWWIVG---FYWIT  200 (325)
Q Consensus       184 lt~Ff~VWfVVG---f~WV~  200 (325)
                      +-+|.++|++.|   =.|+|
T Consensus       161 lilf~i~w~~~~g~~~fWlf  180 (224)
T PF03839_consen  161 LILFLITWFFTGGKHGFWLF  180 (224)
T ss_pred             HHHHHHHHHHhcCCCCEEeC
Confidence            456899999983   37999


No 10 
>KOG1341 consensus Na+/K+ transporter [Inorganic ion transport and metabolism]
Probab=21.48  E-value=92  Score=34.43  Aligned_cols=29  Identities=28%  Similarity=0.299  Sum_probs=24.3

Q ss_pred             chHHHHHhHHHHHHHHHHHhhhhee----eeec
Q 020539          173 DSSVAKNLESANTFLSFLWWIVGFY----WITA  201 (325)
Q Consensus       173 ~~~l~k~le~~lt~Ff~VWfVVGf~----WV~~  201 (325)
                      .++-.|.+-+++..++.+|=++|||    |+..
T Consensus       456 EyRAlk~Lcsil~vY~l~~nIvafV~llv~i~t  488 (854)
T KOG1341|consen  456 EYRALKCLCSILVVYFLGWNIVAFVTLLVFIYT  488 (854)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            3677888999999999999999987    6653


No 11 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=21.47  E-value=1.4e+02  Score=25.72  Aligned_cols=26  Identities=23%  Similarity=0.300  Sum_probs=20.8

Q ss_pred             chHHHHHhHHHHHHHHHHHhhhheee
Q 020539          173 DSSVAKNLESANTFLSFLWWIVGFYW  198 (325)
Q Consensus       173 ~~~l~k~le~~lt~Ff~VWfVVGf~W  198 (325)
                      .+.+++-+=++..+|+++||..+-.|
T Consensus        79 ls~v~Nilvsv~~~~~~~~~~~~~~~  104 (142)
T PF11712_consen   79 LSTVFNILVSVFAVFFAGWYWAGYSF  104 (142)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            46788888899999999997776555


No 12 
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=20.89  E-value=2.5e+02  Score=28.93  Aligned_cols=16  Identities=19%  Similarity=0.833  Sum_probs=12.2

Q ss_pred             HHHHHHHhhhh---eeeee
Q 020539          185 TFLSFLWWIVG---FYWIT  200 (325)
Q Consensus       185 t~Ff~VWfVVG---f~WV~  200 (325)
                      -+|..+|.+.|   =+|+|
T Consensus       241 ILF~I~~il~~g~~g~W~F  259 (372)
T KOG2927|consen  241 ILFGITWILTGGKHGFWLF  259 (372)
T ss_pred             HHHHHHHHHhCCCCceEec
Confidence            35777888887   56988


No 13 
>PF12751 Vac7:  Vacuolar segregation subunit 7;  InterPro: IPR024260 Vac7 is localised at the vacuole membrane, a location which is consistent with its involvement in vacuole morphology and inheritance []. Vac7 has been shown to function as an upstream regulator of the Fab1 lipid kinase pathway []. The Fab1 lipid pathway is important for correct regulation of membrane trafficking events.
Probab=20.48  E-value=1.3e+02  Score=31.02  Aligned_cols=34  Identities=21%  Similarity=0.195  Sum_probs=20.7

Q ss_pred             ccccccCccchhhHHHHHHHHHHHHHhhhhcccC
Q 020539           75 QSYWAYSRPIIVLDVLWNLVFVIVAFAVLGVSIN  108 (325)
Q Consensus        75 ~s~wayS~pwi~lelvwnlaqIvaaivVL~lSk~  108 (325)
                      .+-|.-.+.+++|-|++.|+--.+..+||+.+|.
T Consensus       296 r~~~~r~~~c~~~~i~~lL~ig~~~gFv~AttKp  329 (387)
T PF12751_consen  296 RSWFSRFASCIYLSILLLLVIGFAIGFVFATTKP  329 (387)
T ss_pred             ccHHhhhhHHHHHHHHHHHHHHHHHHhhhhcCcc
Confidence            4566666677777776655544455566666553


Done!