Citrus Sinensis ID: 020546


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-----
MMMMTMEGMMDKVVLDDIIRRLLEGRGGKQVQLSESEIRQLCVNARQIFLSQPNLVEVEAPIRICGDVHGQYQDLLRLFEHGGYPPTANYLFLGDYVDRGKQSLETICLLLAYKIRYPDKIHLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALINEKILCMHGGLSPELENLDQIRNISRPTDIPDNGLLCDLLWSDPDANIEGWADSDRGVSCTFGSDVVADFLDKNDLDLICRGHQVVEDGYEFFARRRLVTIFSAPNYGGEFDNAGALLSVNESLVCSFEILKPADKSLPSSSNSKLPLKKPPKTGKI
ccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccEEEEcccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHccHHHHHHHHHHcccccHHEEEcccEEEEccccccccccHHHHHHccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccc
***********KVVLDDIIRRLLEGRGGKQVQLSESEIRQLCVNARQIFLSQPNLVEVEAPIRICGDVHGQYQDLLRLFEHGGYPPTANYLFLGDYVDRGKQSLETICLLLAYKIRYPDKIHLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALINEKILCMHGGLSPELENLDQIRNISRPTDIPDNGLLCDLLWSDPDANIEGWADSDRGVSCTFGSDVVADFLDKNDLDLICRGHQVVEDGYEFFARRRLVTIFSAPNYGGEFDNAGALLSVNESLVCSFEIL**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMMTMEGMMDKVVLDDIIRRLLEGRGGKQVQLSESEIRQLCVNARQIFLSQPNLVEVEAPIRICGDVHGQYQDLLRLFEHGGYPPTANYLFLGDYVDRGKQSLETICLLLAYKIRYPDKIHLLRGNHEDAKINRIYGFYDECKRRFNVRLWKIFTDCFNCLPVAALINEKILCMHGGLSPELENLDQIRNISRPTDIPDNGLLCDLLWSDPDANIEGWADSDRGVSCTFGSDVVADFLDKNDLDLICRGHQVVEDGYEFFARRRLVTIFSAPNYGGEFDNAGALLSVNESLVCSFEILKPADKSLPSSSNSKLPLKKPPKTGKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase PP1-2 Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation.confidentP32598
Serine/threonine-protein phosphatase PP1 Plays an important role in the control of mitosis by reversing the action of the nimA kinase.confidentP20654
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Dephosphorylates RPS6KB1. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.confidentQ8MJ46

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E7A, chain A
Confidence level:very confident
Coverage over the Query: 13-302
View the alignment between query and template
View the model in PyMOL