Citrus Sinensis ID: 020576

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MAEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
ccccEEEccccEEEEccccEEEccccccccccccccccccEEEEEEEEcccccEEEEEEEcccccccccccccEEEEEEcccEEEcccccHHHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccHHccccccccEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEccccEEEEEcccccHHHHHHHHHHHHHHHcc
ccHHHHHcccEEEEEcccEEEEcccccccccccccccccccEEEEEEEccccccEEEEEccccccccccccccEEEEEccccEEEcccccHHHHHHHHHHHHHccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHcccccEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccHccccccHHHHHHHHHHHccccccccccccccccccccccHHccccccEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEccccHHHHHHHHHHHHHHHcc
MAEVASELLPLLRvykdgsverlsgspmvlpspdedpetgvsskditisenpkisarvylpklaqpistqklpilfythgggfcfeSAFSLVETKLMNALVSEAKVVAISIEYrlapehplpiayedSWSALQWVASHSvnnggfdnkepwlarfgdfdrvfvagdsaganiAHHVVMRAGREKLAGGVKILGAflthpyfwgskpvgsedtrDFEKLLPSLVWkflcpnvaggadnpminvvspeaptlaQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
MAEVASELLPLLRVYKDgsverlsgspmvlpspdedpeTGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVaeldvlrdrGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
MAEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESgwegevelvqvegeDHAFHILKYETENARKMIKRLGSFVLKQ
**********LLRVY**************************************ISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSF****
*AEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
MAEVASELLPLLRVYKDGSVERLSGSPMVLP************KDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
MAEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVLKQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query324 2.2.26 [Sep-21-2011]
Q9SMN0324 Probable carboxylesterase yes no 0.969 0.969 0.444 3e-72
Q9SMM9329 Probable carboxylesterase no no 0.969 0.954 0.428 3e-72
Q9SX78314 Probable carboxylesterase no no 0.932 0.961 0.431 8e-71
Q9ZQ91312 Probable carboxylesterase no no 0.947 0.983 0.436 2e-69
Q9FX93374 Probable carboxylesterase no no 0.935 0.810 0.441 3e-65
Q9LMA7318 Probable carboxylesterase no no 0.953 0.971 0.402 3e-64
Q9FX92315 Probable carboxylesterase no no 0.925 0.952 0.396 4e-64
Q9FX94319 Probable carboxylesterase no no 0.966 0.981 0.410 6e-59
Q9LFR7344 Probable carboxylesterase no no 0.932 0.877 0.327 4e-37
Q9SX25336 Probable carboxylesterase no no 0.919 0.886 0.351 1e-36
>sp|Q9SMN0|CXE12_ARATH Probable carboxylesterase 12 OS=Arabidopsis thaliana GN=CXE12 PE=2 SV=1 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 207/324 (63%), Gaps = 10/324 (3%)

Query: 2   AEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLP 61
           +E+A +  PLL++YK G +ERL G   V PS   +P+ GV SKD+  S +  +S R+YLP
Sbjct: 3   SEIAVDCSPLLKIYKSGRIERLMGEATVPPS--SEPQNGVVSKDVVYSADNNLSVRIYLP 60

Query: 62  KLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPL 121
           + A   +  KLP+L Y HGGGF  E+AFS      +   VS +  VA+S++YR APEHP+
Sbjct: 61  EKAAAETDSKLPLLVYFHGGGFIIETAFSPTYHTFLTTSVSASNCVAVSVDYRRAPEHPI 120

Query: 122 PIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAG 181
            + ++DSW+AL+WV +H   +G    +E WL +  DF RVF++GDSAGANI HH+ MRA 
Sbjct: 121 SVPFDDSWTALKWVFTHITGSG----QEDWLNKHADFSRVFLSGDSAGANIVHHMAMRAA 176

Query: 182 REKLAGGVK---ILGAFLTHPYFWGSKPVGSEDTRDFE-KLLPSLVWKFLCPNVAGGADN 237
           +EKL+ G+    I G  L HPYFW   P+  +DT+D   ++     W    PN   G D+
Sbjct: 177 KEKLSPGLNDTGISGIILLHPYFWSKTPIDEKDTKDETLRMKIEAFWMMASPNSKDGTDD 236

Query: 238 PMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGED 297
           P++NVV  E+  L+ LGC ++LV VAE D L  +G  Y   +++SGW+GEVE+V+ EGED
Sbjct: 237 PLLNVVQSESVDLSGLGCGKVLVMVAEKDALVRQGWGYAAKLEKSGWKGEVEVVESEGED 296

Query: 298 HAFHILKYETENARKMIKRLGSFV 321
           H FH+LK E +NA +++ +   F+
Sbjct: 297 HVFHLLKPECDNAIEVMHKFSGFI 320
Carboxylesterase acting on esters with varying acyl chain length.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 1
>sp|Q9SMM9|CXE13_ARATH Probable carboxylesterase 13 OS=Arabidopsis thaliana GN=CXE13 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX78|CXE2_ARATH Probable carboxylesterase 2 OS=Arabidopsis thaliana GN=CXE2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQ91|CXE7_ARATH Probable carboxylesterase 7 OS=Arabidopsis thaliana GN=CXE7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX93|CXE4_ARATH Probable carboxylesterase 4 OS=Arabidopsis thaliana GN=CXE4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMA7|CXE1_ARATH Probable carboxylesterase 1 OS=Arabidopsis thaliana GN=CXE1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX92|CXE3_ARATH Probable carboxylesterase 3 OS=Arabidopsis thaliana GN=CXE3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FX94|CXE5_ARATH Probable carboxylesterase 5 OS=Arabidopsis thaliana GN=CXE5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFR7|CXE17_ARATH Probable carboxylesterase 17 OS=Arabidopsis thaliana GN=CXE17 PE=2 SV=1 Back     alignment and function description
>sp|Q9SX25|CXE6_ARATH Probable carboxylesterase 6 OS=Arabidopsis thaliana GN=CXE6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
255552323323 catalytic, putative [Ricinus communis] g 0.978 0.981 0.682 1e-122
82697947339 CXE carboxylesterase [Malus pumila] 0.990 0.946 0.6 1e-108
56692178328 2-Hydroxyisoflavanone dehydratase [Glycy 0.978 0.966 0.593 1e-105
82697977332 CXE carboxylesterase [Actinidia eriantha 0.959 0.936 0.6 1e-101
388502876323 unknown [Medicago truncatula] 0.972 0.975 0.559 1e-100
225432588322 PREDICTED: probable carboxylesterase 2-l 0.959 0.965 0.585 1e-99
357444337347 Hormone-sensitive lipase [Medicago trunc 0.959 0.896 0.566 3e-99
358248442343 uncharacterized protein LOC100785409 [Gl 0.972 0.918 0.573 4e-97
351721981319 2-hydroxyisoflavanone dehydratase [Glyci 0.975 0.990 0.537 5e-97
356495801333 PREDICTED: probable carboxylesterase 2-l 0.975 0.948 0.532 8e-97
>gi|255552323|ref|XP_002517206.1| catalytic, putative [Ricinus communis] gi|223543841|gb|EEF45369.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 256/321 (79%), Gaps = 4/321 (1%)

Query: 3   EVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPK 62
           EV SELLP LRVYKDGSVERL GSP+V P+  EDPETGVSSKDITIS++P ISAR+YLPK
Sbjct: 7   EVESELLPFLRVYKDGSVERLIGSPIV-PASIEDPETGVSSKDITISQDPPISARLYLPK 65

Query: 63  LAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLP 122
             +P   QKL +LFY HGGGFC ESAFSL ETK MN+LVS AKVVAIS+EYRLAPEHPL 
Sbjct: 66  FTEP--NQKLAVLFYCHGGGFCIESAFSLTETKYMNSLVSLAKVVAISVEYRLAPEHPLS 123

Query: 123 IAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGR 182
           + YED W ALQWVA HS  N   +NK+PW+   GDF R+F+ GDSAGANIAH++VM+ G 
Sbjct: 124 VVYEDCWVALQWVAMHSDKNE-LENKDPWIFNHGDFSRLFIGGDSAGANIAHNMVMKVGS 182

Query: 183 EKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINV 242
           E L   +K+LGA+LTHPYFWGSK VGSE T + E+ LP  VW FL P+  GG DN MIN 
Sbjct: 183 EGLKSDIKLLGAYLTHPYFWGSKAVGSESTIEREQHLPYRVWSFLYPSAPGGIDNSMINP 242

Query: 243 VSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHI 302
           V+P AP+LA LG  RLL+SVAE D LR+RGILYYN VKESGW+GE++L++VEGEDHAFHI
Sbjct: 243 VAPGAPSLAGLGGSRLLISVAEKDELRERGILYYNVVKESGWKGEIQLIEVEGEDHAFHI 302

Query: 303 LKYETENARKMIKRLGSFVLK 323
           L +ETE A+ +IKRL SF+L 
Sbjct: 303 LNFETEKAKNLIKRLASFLLN 323

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|82697947|gb|ABB89008.1| CXE carboxylesterase [Malus pumila] Back     alignment and taxonomy information
>gi|56692178|dbj|BAD80839.1| 2-Hydroxyisoflavanone dehydratase [Glycyrrhiza echinata] Back     alignment and taxonomy information
>gi|82697977|gb|ABB89023.1| CXE carboxylesterase [Actinidia eriantha] Back     alignment and taxonomy information
>gi|388502876|gb|AFK39504.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225432588|ref|XP_002277866.1| PREDICTED: probable carboxylesterase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357444337|ref|XP_003592446.1| Hormone-sensitive lipase [Medicago truncatula] gi|355481494|gb|AES62697.1| Hormone-sensitive lipase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248442|ref|NP_001239627.1| uncharacterized protein LOC100785409 [Glycine max] gi|255639291|gb|ACU19943.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351721981|ref|NP_001237228.1| 2-hydroxyisoflavanone dehydratase [Glycine max] gi|56692180|dbj|BAD80840.1| 2-hydroxyisoflavanone dehydratase [Glycine max] gi|255644388|gb|ACU22699.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356495801|ref|XP_003516761.1| PREDICTED: probable carboxylesterase 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
TAIR|locus:2114450324 CXE12 [Arabidopsis thaliana (t 0.966 0.966 0.418 2.8e-66
TAIR|locus:2015413314 AT1G47480 [Arabidopsis thalian 0.932 0.961 0.425 3.3e-63
TAIR|locus:2114480329 CXE13 "carboxyesterase 13" [Ar 0.969 0.954 0.407 1.8e-62
TAIR|locus:2012131374 AT1G49650 [Arabidopsis thalian 0.959 0.831 0.414 1e-61
TAIR|locus:2063751312 AT2G03550 [Arabidopsis thalian 0.947 0.983 0.414 1.3e-59
TAIR|locus:2012196315 AT1G49640 [Arabidopsis thalian 0.925 0.952 0.377 5.7e-59
TAIR|locus:2012227319 CXE5 "carboxyesterase 5" [Arab 0.966 0.981 0.382 1.7e-57
TAIR|locus:2202190318 AT1G19190 [Arabidopsis thalian 0.950 0.968 0.396 7.5e-57
TAIR|locus:2146097344 CXE17 "AT5G16080" [Arabidopsis 0.932 0.877 0.321 5.1e-35
TAIR|locus:2026920336 AT1G68620 [Arabidopsis thalian 0.861 0.830 0.351 4.6e-34
TAIR|locus:2114450 CXE12 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 674 (242.3 bits), Expect = 2.8e-66, P = 2.8e-66
 Identities = 136/325 (41%), Positives = 195/325 (60%)

Query:     2 AEVASELLPLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLP 61
             +E+A +  PLL++YK G +ERL G   V PS   +P+ GV SKD+  S +  +S R+YLP
Sbjct:     3 SEIAVDCSPLLKIYKSGRIERLMGEATVPPS--SEPQNGVVSKDVVYSADNNLSVRIYLP 60

Query:    62 KLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPL 121
             + A   +  KLP+L Y HGGGF  E+AFS      +   VS +  VA+S++YR APEHP+
Sbjct:    61 EKAAAETDSKLPLLVYFHGGGFIIETAFSPTYHTFLTTSVSASNCVAVSVDYRRAPEHPI 120

Query:   122 PIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAG 181
              + ++DSW+AL+WV +H   +G    +E WL +  DF RVF++GDSAGANI HH+ MRA 
Sbjct:   121 SVPFDDSWTALKWVFTHITGSG----QEDWLNKHADFSRVFLSGDSAGANIVHHMAMRAA 176

Query:   182 REKLAGGVK---ILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSL--VWKFLCPNVAGGAD 236
             +EKL+ G+    I G  L HPYFW   P+  +DT+D E L   +   W    PN   G D
Sbjct:   177 KEKLSPGLNDTGISGIILLHPYFWSKTPIDEKDTKD-ETLRMKIEAFWMMASPNSKDGTD 235

Query:   237 NPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESXXXXXXXXXXXXXX 296
             +P++NVV  E+  L+ LGC ++LV VAE D L  +G  Y   +++S              
Sbjct:   236 DPLLNVVQSESVDLSGLGCGKVLVMVAEKDALVRQGWGYAAKLEKSGWKGEVEVVESEGE 295

Query:   297 DHAFHILKYETENARKMIKRLGSFV 321
             DH FH+LK E +NA +++ +   F+
Sbjct:   296 DHVFHLLKPECDNAIEVMHKFSGFI 320
GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0004091 "carboxylesterase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=NAS
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2015413 AT1G47480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114480 CXE13 "carboxyesterase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012131 AT1G49650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063751 AT2G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012196 AT1G49640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012227 CXE5 "carboxyesterase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202190 AT1G19190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146097 CXE17 "AT5G16080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026920 AT1G68620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SMN0CXE12_ARATH3, ., 1, ., 1, ., 10.44440.96910.9691yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
pfam07859207 pfam07859, Abhydrolase_3, alpha/beta hydrolase fol 1e-54
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 3e-31
PRK10162318 PRK10162, PRK10162, acetyl esterase; Provisional 3e-11
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 7e-08
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 1e-06
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 1e-05
>gnl|CDD|219611 pfam07859, Abhydrolase_3, alpha/beta hydrolase fold Back     alignment and domain information 
 Score =  177 bits (450), Expect = 1e-54
 Identities = 83/234 (35%), Positives = 111/234 (47%), Gaps = 33/234 (14%)

Query: 75  LFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQW 134
           L Y HGGGF   SA +    +L   L + A  V +S++YRLAPEHP P A ED+++AL+W
Sbjct: 1   LVYFHGGGFVLGSADT--HDRLCRRLAAAAGAVVVSVDYRLAPEHPFPAAIEDAYAALRW 58

Query: 135 VASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGA 194
           +A H+   G             D  R+ VAGDSAG N+A  V +RA  E   G     G 
Sbjct: 59  LAEHAWELG------------ADPSRIAVAGDSAGGNLAAAVALRARDE---GLPLPAGQ 103

Query: 195 FLTHPYFWGSKPVGSEDTRDF--EKLLPS----LVWKFLCPNVAGGADNPMINVVSPEAP 248
            L +P         SE   ++    LL        W+   P      D+P+ +     A 
Sbjct: 104 VLIYP--GLDLRTESESYNEYADGPLLTRDDMDWFWRLYLP--GADRDDPLASP--LFAA 157

Query: 249 TLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHI 302
            L+  G    LV VAE D LRD G  Y   ++ +G   EVELV+  G  H FH+
Sbjct: 158 DLS--GLPPALVVVAEFDPLRDEGEAYAERLRAAG--VEVELVEYPGMIHGFHL 207

This catalytic domain is found in a very wide range of enzymes. Length = 207
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236660 PRK10162, PRK10162, acetyl esterase; Provisional Back     alignment and domain information
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 324
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 100.0
PRK10162318 acetyl esterase; Provisional 100.0
COG0657312 Aes Esterase/lipase [Lipid metabolism] 100.0
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.97
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.92
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.88
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.87
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.86
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.86
PLN02298330 hydrolase, alpha/beta fold family protein 99.86
PLN02385349 hydrolase; alpha/beta fold family protein 99.85
PLN02442283 S-formylglutathione hydrolase 99.85
PRK10566249 esterase; Provisional 99.85
PRK13604307 luxD acyl transferase; Provisional 99.84
PHA02857276 monoglyceride lipase; Provisional 99.83
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.83
PRK10115686 protease 2; Provisional 99.82
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.8
PRK10749330 lysophospholipase L2; Provisional 99.8
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.79
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.79
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 99.79
PLN02652395 hydrolase; alpha/beta fold family protein 99.79
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.76
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.76
PLN00021313 chlorophyllase 99.76
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.75
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.75
PRK00870302 haloalkane dehalogenase; Provisional 99.73
COG1647243 Esterase/lipase [General function prediction only] 99.72
PRK11460232 putative hydrolase; Provisional 99.72
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.71
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.71
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.7
PLN02824294 hydrolase, alpha/beta fold family protein 99.7
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.7
PRK10985324 putative hydrolase; Provisional 99.69
PLN02511388 hydrolase 99.69
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.68
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.68
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.67
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.66
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 99.65
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.65
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.65
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.65
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.65
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.64
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.64
PRK10673255 acyl-CoA esterase; Provisional 99.64
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.63
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.62
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.62
PLN02894402 hydrolase, alpha/beta fold family protein 99.6
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.59
PLN02679360 hydrolase, alpha/beta fold family protein 99.59
PRK06489360 hypothetical protein; Provisional 99.59
COG0400207 Predicted esterase [General function prediction on 99.59
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.58
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.58
PRK03204286 haloalkane dehalogenase; Provisional 99.58
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.58
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.58
PLN02965255 Probable pheophorbidase 99.58
PRK03592295 haloalkane dehalogenase; Provisional 99.57
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.57
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.57
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.56
PRK11071190 esterase YqiA; Provisional 99.56
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.55
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.53
PRK10349256 carboxylesterase BioH; Provisional 99.53
COG4099387 Predicted peptidase [General function prediction o 99.52
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.52
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.51
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.5
PRK07581339 hypothetical protein; Validated 99.5
PLN02578354 hydrolase 99.49
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.49
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.49
KOG3043242 consensus Predicted hydrolase related to dienelact 99.47
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.47
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.47
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.46
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.46
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.46
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.44
PLN02872395 triacylglycerol lipase 99.43
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.41
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.41
PLN02211273 methyl indole-3-acetate methyltransferase 99.4
KOG3101283 consensus Esterase D [General function prediction 99.4
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.39
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.37
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.36
PRK08775343 homoserine O-acetyltransferase; Provisional 99.36
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.35
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.34
KOG4667269 consensus Predicted esterase [Lipid transport and 99.32
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.3
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.3
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.28
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.28
KOG1516 545 consensus Carboxylesterase and related proteins [G 99.27
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 99.26
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.24
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.2
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.17
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 99.16
KOG2984277 consensus Predicted hydrolase [General function pr 99.14
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.14
PRK07868 994 acyl-CoA synthetase; Validated 99.14
PRK05855 582 short chain dehydrogenase; Validated 99.13
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.12
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.11
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.11
COG0627316 Predicted esterase [General function prediction on 99.1
PRK06765389 homoserine O-acetyltransferase; Provisional 99.1
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.07
COG3208244 GrsT Predicted thioesterase involved in non-riboso 99.06
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.03
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.03
KOG2237712 consensus Predicted serine protease [Posttranslati 98.99
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.94
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.94
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 98.83
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.79
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.77
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.72
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 98.68
COG2936 563 Predicted acyl esterases [General function predict 98.66
PRK04940180 hypothetical protein; Provisional 98.65
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.65
COG4188365 Predicted dienelactone hydrolase [General function 98.64
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.57
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.53
TIGR01839 560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.53
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.47
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.43
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.43
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.41
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.38
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.37
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.28
COG4814288 Uncharacterized protein with an alpha/beta hydrola 98.27
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.25
COG4757281 Predicted alpha/beta hydrolase [General function p 98.22
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 98.22
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.22
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.17
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.16
KOG4840299 consensus Predicted hydrolases or acyltransferases 98.13
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 98.11
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 98.09
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.01
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 97.94
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.94
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 97.91
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.86
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 97.86
COG1073299 Hydrolases of the alpha/beta superfamily [General 97.85
COG3150191 Predicted esterase [General function prediction on 97.83
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.79
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.79
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.68
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 97.67
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.64
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 97.61
KOG3975301 consensus Uncharacterized conserved protein [Funct 97.6
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.52
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.4
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.36
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.33
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.22
COG3319257 Thioesterase domains of type I polyketide synthase 97.22
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 97.22
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 97.1
KOG3967297 consensus Uncharacterized conserved protein [Funct 97.09
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 97.01
PLN02606306 palmitoyl-protein thioesterase 96.94
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 96.71
PF03283361 PAE: Pectinacetylesterase 96.71
COG1075336 LipA Predicted acetyltransferases and hydrolases w 96.7
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.67
PLN02209 437 serine carboxypeptidase 96.61
KOG3724 973 consensus Negative regulator of COPII vesicle form 96.56
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 96.46
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.42
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 96.4
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.35
PRK102521296 entF enterobactin synthase subunit F; Provisional 96.3
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 96.28
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.08
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 96.07
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 95.73
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 95.67
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 95.26
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.08
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 94.84
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 94.66
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 94.55
PLN02454414 triacylglycerol lipase 94.51
PLN02633314 palmitoyl protein thioesterase family protein 94.44
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 94.18
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 93.64
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 93.56
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 93.24
PLN02408365 phospholipase A1 92.91
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 92.85
PLN02571413 triacylglycerol lipase 92.75
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 92.58
PLN00413479 triacylglycerol lipase 91.91
KOG2369 473 consensus Lecithin:cholesterol acyltransferase (LC 91.33
PLN02324415 triacylglycerol lipase 91.0
PLN02934515 triacylglycerol lipase 90.87
PLN02802509 triacylglycerol lipase 90.86
PLN02162475 triacylglycerol lipase 90.54
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 89.25
PF10605690 3HBOH: 3HB-oligomer hydrolase (3HBOH) ; InterPro: 89.04
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 88.89
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 88.82
PLN02310405 triacylglycerol lipase 88.52
PLN03037525 lipase class 3 family protein; Provisional 88.52
PLN02753531 triacylglycerol lipase 88.24
KOG2521350 consensus Uncharacterized conserved protein [Funct 88.14
KOG4569336 consensus Predicted lipase [Lipid transport and me 87.96
PLN02847 633 triacylglycerol lipase 87.74
PLN02719518 triacylglycerol lipase 87.02
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 86.48
KOG1551371 consensus Uncharacterized conserved protein [Funct 86.44
PLN02761527 lipase class 3 family protein 86.16
KOG4540425 consensus Putative lipase essential for disintegra 83.98
COG5153425 CVT17 Putative lipase essential for disintegration 83.98
PF10081289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 83.62
COG3673 423 Uncharacterized conserved protein [Function unknow 83.13
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 81.99
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 80.66
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-39  Score=288.00  Aligned_cols=297  Identities=43%  Similarity=0.700  Sum_probs=252.2

Q ss_pred             hcceeeecCCceEEecCC-CCCCCCCCCCCCCCcceeeEecCCCCceEEEEeccCCCCCCCCCCCcEEEEEcCCcccccC
Q 020576            9 LPLLRVYKDGSVERLSGS-PMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPISTQKLPILFYTHGGGFCFES   87 (324)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~ly~P~~~~~~~~~~~pvvv~iHGgg~~~~~   87 (324)
                      .+.+++.+++++.|.+.. +..|+..  +|..++..++|.+....++.+++|.|...  .+..+.|+|||+|||||..++
T Consensus        30 ~~~i~i~~~~~~~r~~~~~~~~p~~~--~p~~~v~~~dv~~~~~~~l~vRly~P~~~--~~~~~~p~lvyfHGGGf~~~S  105 (336)
T KOG1515|consen   30 FENIRIFKDGSFERFFGRFDKVPPSS--DPVNGVTSKDVTIDPFTNLPVRLYRPTSS--SSETKLPVLVYFHGGGFCLGS  105 (336)
T ss_pred             hhhceeecCCceeeeecccccCCCCC--CcccCceeeeeEecCCCCeEEEEEcCCCC--CcccCceEEEEEeCCccEeCC
Confidence            677899999999999986 7888888  88899999999999999999999999987  223689999999999999999


Q ss_pred             CcchhHHHHHHHHHHhCCcEEEEeecccCCCCCCCcchHHHHHHHHHHHHhccCCCCCCCCCcccccCCCCCcEEEEecC
Q 020576           88 AFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDS  167 (324)
Q Consensus        88 ~~~~~~~~~~~~~~~~~g~~v~~~dyr~~~~~~~~~~~~D~~~~~~~l~~~~~~~~~~~~~~~~~~~~~d~~~i~l~G~S  167 (324)
                      ..+..|+.++.+++.+.+++|+++|||+.|++++|.+++|..+++.|+.++.           |+..++|++||+|+|.|
T Consensus       106 ~~~~~y~~~~~~~a~~~~~vvvSVdYRLAPEh~~Pa~y~D~~~Al~w~~~~~-----------~~~~~~D~~rv~l~GDS  174 (336)
T KOG1515|consen  106 ANSPAYDSFCTRLAAELNCVVVSVDYRLAPEHPFPAAYDDGWAALKWVLKNS-----------WLKLGADPSRVFLAGDS  174 (336)
T ss_pred             CCCchhHHHHHHHHHHcCeEEEecCcccCCCCCCCccchHHHHHHHHHHHhH-----------HHHhCCCcccEEEEccC
Confidence            8888899999999999999999999999999999999999999999999862           23338999999999999


Q ss_pred             chhHHHHHHHHHhhcccccCccceeEEEeeccccCCCCCCCCCCc------ccccccchHHHHHhhcCCCCCCCCCCccc
Q 020576          168 AGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDT------RDFEKLLPSLVWKFLCPNVAGGADNPMIN  241 (324)
Q Consensus       168 ~GG~~a~~~~~~~~~~~~~~~~~~~~~i~~~p~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  241 (324)
                      +||++|..++++..+.. ..+.+++++|+++|++........+..      ...........|..+.|.......++.++
T Consensus       175 aGGNia~~va~r~~~~~-~~~~ki~g~ili~P~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~w~~~lP~~~~~~~~p~~n  253 (336)
T KOG1515|consen  175 AGGNIAHVVAQRAADEK-LSKPKIKGQILIYPFFQGTDRTESEKQQNLNGSPELARPKIDKWWRLLLPNGKTDLDHPFIN  253 (336)
T ss_pred             ccHHHHHHHHHHHhhcc-CCCcceEEEEEEecccCCCCCCCHHHHHhhcCCcchhHHHHHHHHHHhCCCCCCCcCCcccc
Confidence            99999999999876543 224579999999999988776654322      11234456778888888873368888998


Q ss_pred             ccC-CCccccccCCCCcEEEEEcCccchhhcHHHHHHHHHhCCCCcceEEEEeCCCcccccccCcchHHHHHHHHHHHHH
Q 020576          242 VVS-PEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSF  320 (324)
Q Consensus       242 ~~~-~~~~~~~~~~~~P~lii~G~~D~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~i~~f  320 (324)
                      |.. ..........++|+|++.++.|.+.+++..|+++|+++|+  +++++.++++.|+|....+..+.+.+.++.+.+|
T Consensus       254 p~~~~~~~d~~~~~lp~tlv~~ag~D~L~D~~~~Y~~~Lkk~Gv--~v~~~~~e~~~H~~~~~~~~~~~a~~~~~~i~~f  331 (336)
T KOG1515|consen  254 PVGNSLAKDLSGLGLPPTLVVVAGYDVLRDEGLAYAEKLKKAGV--EVTLIHYEDGFHGFHILDPSSKEAHALMDAIVEF  331 (336)
T ss_pred             ccccccccCccccCCCceEEEEeCchhhhhhhHHHHHHHHHcCC--eEEEEEECCCeeEEEecCCchhhHHHHHHHHHHH
Confidence            887 3222333333338999999999999999999999999999  8999999999999999888778999999999999


Q ss_pred             HHc
Q 020576          321 VLK  323 (324)
Q Consensus       321 l~~  323 (324)
                      +++
T Consensus       332 i~~  334 (336)
T KOG1515|consen  332 IKS  334 (336)
T ss_pred             Hhh
Confidence            986

>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF10605 3HBOH: 3HB-oligomer hydrolase (3HBOH) ; InterPro: IPR016582 This entry represents a group of predicted D-(-)-3-hydroxybutyrate oligomer hydrolases (also known as 3HB-oligomer hydrolase), which function in the degradation of poly-3-hydroxybutyrate (PHB) Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG3673 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2zsh_A351 Structural Basis Of Gibberellin(Ga3)-Induced Della 6e-32
3ebl_A365 Crystal Structure Of Rice Gid1 Complexed With Ga4 L 1e-30
2o7r_A338 Plant Carboxylesterase Aecxe1 From Actinidia Eriant 6e-30
3aio_A323 R267k Mutant Of A Hsl-Like Carboxylesterase From Su 7e-16
3ain_A323 R267g Mutant Of A Hsl-Like Carboxylesterase From Su 8e-16
3aim_A323 R267e Mutant Of A Hsl-Like Carboxylesterase From Su 8e-16
3aik_A323 Crystal Structure Of A Hsl-Like Carboxylesterase Fr 8e-16
2c7b_A311 The Crystal Structure Of Este1, A New Thermophilic 1e-15
2yh2_A313 Pyrobaculum Calidifontis Esterase Monoclinic Form L 8e-15
1qz3_A310 Crystal Structure Of Mutant M211sR215L OF CARBOXYLE 2e-13
1evq_A310 The Crystal Structure Of The Thermophilic Carboxyle 3e-12
2hm7_A310 Crystal Structure Analysis Of The G84s Est2 Mutant 3e-12
1lzk_A323 Bacterial Heroin Esterase Complex With Transition S 6e-12
1lzl_A323 Bacterial Heroin Esterase Length = 323 1e-11
1jji_A311 The Crystal Structure Of A Hyper-Thermophilic Carbo 5e-11
1jkm_B361 Brefeldin A Esterase, A Bacterial Homologue Of Huma 1e-08
3qh4_A317 Crystal Structure Of Esterase Lipw From Mycobacteri 1e-07
3dnm_A336 Crystal Structure Hormone-Sensitive Lipase From A M 5e-07
3k6k_A322 Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Es 7e-07
3fak_A322 Structural And Functional Analysis Of A Hormone-Sen 1e-06
3v9a_A309 Crystal Structure Of EsteraseLIPASE FROM UNCULTURED 2e-06
1thg_A 544 1.8 Angstroms Refined Structure Of The Lipase From 7e-06
1ukc_A 522 Crystal Structure Of Aspergillus Niger Esta Length 2e-04
>pdb|2ZSH|A Chain A, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor Length = 351 Back     alignment and structure 
Iteration: 1

 Score =  134 bits (338), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 129/268 (48%), Gaps = 33/268 (12%)
Query: 32  SPDEDPETGVSSKDITISENPKISARVYLP------------KLAQPISTQKLPILFYTH 79
           + + +P  GV S D+ I     + +RVY P             L +P+    +P++ + H
Sbjct: 61  TANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFH 120
Query: 80  GGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHS 139
           GG F   SA S +   L   LV   K V +S+ YR APE+P P AY+D W AL WV S S
Sbjct: 121 GGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRS 180
Query: 140 VNNGGFDNKEPWLARFGDFD-RVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTH 198
                      WL    D    +F+AGDS+G NIAH+V +RAG      G+ +LG  L +
Sbjct: 181 -----------WLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGES----GIDVLGNILLN 225
Query: 199 PYFWGSKPVGSEDTRDFEKLLP----SLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLG 254
           P F G++   SE + D +  +        WK   P      ++P  N  SP   +L  + 
Sbjct: 226 PMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPE-GEDREHPACNPFSPRGKSLEGVS 284
Query: 255 CRRLLVSVAELDVLRDRGILYYNAVKES 282
             + LV VA LD++RD  + Y   +K++
Sbjct: 285 FPKSLVVVAGLDLIRDWQLAYAEGLKKA 312
>pdb|3EBL|A Chain A, Crystal Structure Of Rice Gid1 Complexed With Ga4 Length = 365 Back     alignment and structure
>pdb|2O7R|A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct Length = 338 Back     alignment and structure
>pdb|3AIO|A Chain A, R267k Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIN|A Chain A, R267g Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIM|A Chain A, R267e Mutant Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|3AIK|A Chain A, Crystal Structure Of A Hsl-Like Carboxylesterase From Sulfolobus Tokodaii Length = 323 Back     alignment and structure
>pdb|2C7B|A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library Length = 311 Back     alignment and structure
>pdb|2YH2|A Chain A, Pyrobaculum Calidifontis Esterase Monoclinic Form Length = 313 Back     alignment and structure
>pdb|1QZ3|A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate Length = 310 Back     alignment and structure
>pdb|1EVQ|A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius Length = 310 Back     alignment and structure
>pdb|2HM7|A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant Length = 310 Back     alignment and structure
>pdb|1LZK|A Chain A, Bacterial Heroin Esterase Complex With Transition State Analog Dimethylarsenic Acid Length = 323 Back     alignment and structure
>pdb|1LZL|A Chain A, Bacterial Heroin Esterase Length = 323 Back     alignment and structure
>pdb|1JJI|A Chain A, The Crystal Structure Of A Hyper-Thermophilic Carboxylesterase From The Archaeon Archaeoglobus Fulgidus Length = 311 Back     alignment and structure
>pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human Hormone Sensitive Lipase Length = 361 Back     alignment and structure
>pdb|3QH4|A Chain A, Crystal Structure Of Esterase Lipw From Mycobacterium Marinum Length = 317 Back     alignment and structure
>pdb|3DNM|A Chain A, Crystal Structure Hormone-Sensitive Lipase From A Metagenome Library Length = 336 Back     alignment and structure
>pdb|3K6K|A Chain A, Crystal Structure At 2.2 Angstrom Of Hsl-Homolog Este7 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|3FAK|A Chain A, Structural And Functional Analysis Of A Hormone-Sensitive Lipase Like Este5 From A Metagenome Library Length = 322 Back     alignment and structure
>pdb|3V9A|A Chain A, Crystal Structure Of EsteraseLIPASE FROM UNCULTURED BACTERIUM Length = 309 Back     alignment and structure
>pdb|1THG|A Chain A, 1.8 Angstroms Refined Structure Of The Lipase From Geotrichum Candidum Length = 544 Back     alignment and structure
>pdb|1UKC|A Chain A, Crystal Structure Of Aspergillus Niger Esta Length = 522 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 1e-120
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 1e-119
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 1e-116
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 4e-40
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 1e-39
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 4e-39
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 7e-39
3ain_A323 303AA long hypothetical esterase; carboxylesterase 1e-38
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 7e-38
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 1e-37
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 3e-37
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 7e-37
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 4e-34
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 2e-33
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 5e-32
3h04_A275 Uncharacterized protein; protein with unknown func 6e-30
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 3e-27
1vkh_A273 Putative serine hydrolase; structural genomics, jo 6e-19
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 5e-15
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 3e-14
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 8e-12
3bjr_A283 Putative carboxylesterase; structural genomics, jo 3e-11
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 3e-10
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 2e-09
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 2e-09
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 5e-09
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 2e-07
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 5e-07
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 7e-07
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 1e-06
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 3e-06
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 3e-06
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 6e-06
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 2e-05
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 2e-05
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 4e-05
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 5e-05
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 6e-05
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 3e-04
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
 Score =  348 bits (895), Expect = e-120
 Identities = 102/342 (29%), Positives = 155/342 (45%), Gaps = 44/342 (12%)

Query: 5   ASELLPLLRVYKDGSVERLSGSPMVLPSP-DEDPETGVSSKDITISENPKISARVYLPKL 63
             +L   +    DG+ ER  G  +    P +  P  GVSS D  I ++  +  R+Y    
Sbjct: 25  NFKLSYNILRRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAA 84

Query: 64  AQPI-------------------STQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEA 104
                                  + +  P++ + HGG F   SA S +   L    V  +
Sbjct: 85  EGDAEEGAAAVTRPILEFLTDAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLS 144

Query: 105 KVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDF-DRVFV 163
           K V +S+ YR APEH  P AY+D W+AL+WV S            P++   GD   RVF+
Sbjct: 145 KGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQ-----------PFMRSGGDAQARVFL 193

Query: 164 AGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPS-- 221
           +GDS+G NIAHHV +RA  E    GVK+ G  L +  F G++   SE   D +  +    
Sbjct: 194 SGDSSGGNIAHHVAVRAADE----GVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQD 249

Query: 222 --LVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAV 279
               WK   P  A   D+P  N   P    L  L   + L+ V+ LD+  DR + Y +A+
Sbjct: 250 RDWYWKAYLPEDA-DRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADAL 308

Query: 280 KESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFV 321
           +E G    V++VQ E     F++L   T +  ++++ +  F+
Sbjct: 309 REDGH--HVKVVQCENATVGFYLLP-NTVHYHEVMEEISDFL 347
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Length = 361 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Length = 304 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 100.0
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 100.0
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 100.0
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 100.0
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 100.0
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 100.0
3ain_A323 303AA long hypothetical esterase; carboxylesterase 100.0
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 100.0
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 100.0
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 100.0
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 100.0
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 100.0
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 100.0
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.97
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.97
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.96
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.96
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.96
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.95
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.95
3h04_A275 Uncharacterized protein; protein with unknown func 99.93
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.93
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.92
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.92
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.91
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.91
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.91
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.91
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.91
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.9
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.9
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.9
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.9
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.9
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.9
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.9
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.89
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.89
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.89
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.89
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.89
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.89
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.89
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.89
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.88
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.88
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.88
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.88
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.88
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.88
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.88
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.88
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.88
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.88
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.87
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.87
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.87
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.87
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.87
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.87
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.87
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.87
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.86
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.86
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.86
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.86
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.85
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.85
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.84
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.84
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.84
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.83
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.83
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.83
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.83
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.82
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.82
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.81
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.81
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.81
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.81
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.81
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.81
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.8
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.8
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.8
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.79
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.79
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.79
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.79
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.79
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.79
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.78
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.78
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.78
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.77
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.77
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.77
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.76
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.76
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.76
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.76
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.75
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.75
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.74
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.74
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.74
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.74
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.74
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.73
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.73
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.73
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.73
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.73
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.73
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.73
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.73
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.72
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.72
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.72
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.72
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.72
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.72
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.72
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.72
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.72
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.71
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.71
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.71
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.71
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.71
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.71
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.71
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.71
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.71
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.71
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.71
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.71
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.71
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.71
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.7
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.7
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.7
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.7
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.7
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.7
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.69
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.69
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.69
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.69
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.69
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.69
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.69
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.69
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.68
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.68
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.68
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.68
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.68
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.68
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.68
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.68
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.67
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.67
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.67
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.67
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.67
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.67
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.67
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.67
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.66
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.66
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.66
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.66
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.65
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.65
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.65
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.65
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.65
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.65
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.65
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.65
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.65
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.64
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.64
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.64
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.63
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.63
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.63
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.63
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.63
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.62
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.62
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.62
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.61
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.61
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.61
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.6
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.59
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.37
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.58
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.58
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.58
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.55
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.54
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.54
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.53
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.51
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.5
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.49
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.45
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.42
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.42
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.41
3lp5_A250 Putative cell surface hydrolase; structural genom 99.4
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.4
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.38
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.37
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.35
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.29
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.27
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.25
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.25
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.21
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.2
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.15
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.14
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.12
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.11
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.09
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.07
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.0
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.94
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.91
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.9
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.88
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.85
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.8
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.76
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.72
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.5
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.46
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 98.36
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.22
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 98.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.91
1ivy_A 452 Human protective protein; carboxypeptidase, serine 97.7
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 97.6
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.42
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 97.08
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 97.06
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 96.98
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 96.94
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 96.81
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 96.05
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 95.4
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 95.32
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 95.31
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 95.23
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 94.94
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 94.67
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 94.66
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 94.29
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 93.85
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 93.77
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 93.55
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 93.1
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 92.99
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 92.8
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 92.06
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 90.6
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 87.4
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 85.21
3r3p_A105 MobIle intron protein; homing endonuclease, hydrol 84.69
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 82.87
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
Probab=100.00  E-value=4e-38  Score=288.03  Aligned_cols=290  Identities=33%  Similarity=0.523  Sum_probs=226.4

Q ss_pred             eecCCceEEecCC---CCCCCCCCCCCCCCcceeeEecCCCCceEEEEec-cCCCC------------------CCCCCC
Q 020576           14 VYKDGSVERLSGS---PMVLPSPDEDPETGVSSKDITISENPKISARVYL-PKLAQ------------------PISTQK   71 (324)
Q Consensus        14 ~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~ly~-P~~~~------------------~~~~~~   71 (324)
                      ...||++.|.+..   +..|+.+  ++..++.++++.++..+++.+++|+ |+...                  ....++
T Consensus        34 ~~~dg~v~r~~~~~~~~~~~~~~--~~~~~v~~~dv~~~~~~gl~~~~~~~P~~~~~~~~~~~~~~~~l~~~~~~~~~~~  111 (365)
T 3ebl_A           34 RRADGTFERDLGEYLDRRVPANA--RPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPAAEP  111 (365)
T ss_dssp             BCTTSCBCHHHHHHHSCBCCCCS--SCBTTEEEEEEEEETTTTEEEEEEEEC----------------CGGGGSCCBSSC
T ss_pred             cCCCCceEecCcccccCCCCCCC--CCCCCCceeeEEecCCCCceEEEEeCCCccccccccccccccccccccCCCCCCc
Confidence            3579999987543   4566776  7788999999999988889999998 97530                  123467


Q ss_pred             CcEEEEEcCCcccccCCcchhHHHHHHHHHHhCCcEEEEeecccCCCCCCCcchHHHHHHHHHHHHhccCCCCCCCCCcc
Q 020576           72 LPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHSVNNGGFDNKEPW  151 (324)
Q Consensus        72 ~pvvv~iHGgg~~~~~~~~~~~~~~~~~~~~~~g~~v~~~dyr~~~~~~~~~~~~D~~~~~~~l~~~~~~~~~~~~~~~~  151 (324)
                      .|+|||+|||||..++.....+..++..++.+.|++|+++|||++++..++..++|+.++++|+.++..        .++
T Consensus       112 ~Pvvv~~HGGg~~~g~~~~~~~~~~~~~la~~~g~~Vv~~dyR~~p~~~~~~~~~D~~~a~~~l~~~~~--------~~~  183 (365)
T 3ebl_A          112 FPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMSQPF--------MRS  183 (365)
T ss_dssp             CEEEEEECCSTTTSCCTTBHHHHHHHHHHHHHHTSEEEEECCCCTTTSCTTHHHHHHHHHHHHHHHCTT--------TEE
T ss_pred             ceEEEEEcCCccccCCCchhhHHHHHHHHHHHCCCEEEEeeCCCCCCCCCcHHHHHHHHHHHHHHhCch--------hhh
Confidence            899999999999998887766778888888878999999999999999999999999999999996420        223


Q ss_pred             cccCCCCC-cEEEEecCchhHHHHHHHHHhhcccccCccceeEEEeeccccCCCCCCCCCCcc----cccccchHHHHHh
Q 020576          152 LARFGDFD-RVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHPYFWGSKPVGSEDTR----DFEKLLPSLVWKF  226 (324)
Q Consensus       152 ~~~~~d~~-~i~l~G~S~GG~~a~~~~~~~~~~~~~~~~~~~~~i~~~p~~~~~~~~~~~~~~----~~~~~~~~~~~~~  226 (324)
                         ++|++ +|+|+|+||||++|+.++.+.++..    .+++++|+++|+++...........    ........++|..
T Consensus       184 ---~~d~~~ri~l~G~S~GG~la~~~a~~~~~~~----~~~~g~vl~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  256 (365)
T 3ebl_A          184 ---GGDAQARVFLSGDSSGGNIAHHVAVRAADEG----VKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKA  256 (365)
T ss_dssp             ---TTTTEEEEEEEEETHHHHHHHHHHHHHHHTT----CCCCEEEEESCCCCCSSCCHHHHHHTTTSSCCHHHHHHHHHH
T ss_pred             ---CCCCCCcEEEEeeCccHHHHHHHHHHHHhcC----CceeeEEEEccccCCCcCChhhhhcCCCcccCHHHHHHHHHH
Confidence               67998 9999999999999999998876542    2499999999998765432211110    0112334566777


Q ss_pred             hcCCCCCCCCCCcccccCCCccccccCCCCcEEEEEcCccchhhcHHHHHHHHHhCCCCcceEEEEeCCCcccccccCcc
Q 020576          227 LCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYE  306 (324)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~lii~G~~D~~~~~~~~~~~~l~~~g~~~~~~~~~~~~~~H~~~~~~~~  306 (324)
                      +.+.. ....++..+++......++++.++|+||+||++|.+++++..|+++|+++|+  ++++++++|++|+|... +.
T Consensus       257 ~~~~~-~~~~~~~~~p~~~~~~~l~~~~~pP~Li~~G~~D~l~~~~~~~~~~L~~~g~--~v~l~~~~g~~H~f~~~-~~  332 (365)
T 3ebl_A          257 YLPED-ADRDHPACNPFGPNGRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGH--HVKVVQCENATVGFYLL-PN  332 (365)
T ss_dssp             HSCTT-CCTTSTTTCTTSTTCCCCTTSCCCCEEEEEETTSTTHHHHHHHHHHHHHTTC--CEEEEEETTCCTTGGGS-SC
T ss_pred             hCCCC-CCCCCcccCCCCCcchhhccCCCCCEEEEEcCcccchhHHHHHHHHHHHCCC--CEEEEEECCCcEEEecc-CC
Confidence            77655 4555666666654344666333339999999999999999999999999999  99999999999999876 55


Q ss_pred             hHHHHHHHHHHHHHHHcC
Q 020576          307 TENARKMIKRLGSFVLKQ  324 (324)
Q Consensus       307 ~~~~~~~~~~i~~fl~~~  324 (324)
                      .+..+++++.+.+||+++
T Consensus       333 ~~~~~~~~~~i~~Fl~~~  350 (365)
T 3ebl_A          333 TVHYHEVMEEISDFLNAN  350 (365)
T ss_dssp             SHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHh
Confidence            688899999999999864
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>3r3p_A MobIle intron protein; homing endonuclease, hydrolase; 2.20A {Bacillus phage 0305phi8-36} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 324
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 9e-28
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 4e-23
d1u4na_308 c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus a 4e-23
d1jkma_358 c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, 5e-23
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 2e-12
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 2e-07
d1thga_ 544 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fun 3e-07
d2pbla1261 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_ 1e-06
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 2e-05
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 2e-05
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 5e-05
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 5e-05
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 7e-05
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 9e-05
d1ukca_ 517 c.69.1.17 (A:) Esterase EstA {Aspergillus niger [T 0.001
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 0.003
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 0.004
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Carboxylesterase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

 Score =  107 bits (268), Expect = 9e-28
 Identities = 74/304 (24%), Positives = 114/304 (37%), Gaps = 30/304 (9%)

Query: 21  ERLSGSPMVLPSPDEDPETGVSSKDITI-SENPKISARVYLPKLAQPISTQKLPILFYTH 79
           E ++             E     +D TI   N  I  RVY  K          P+L Y H
Sbjct: 34  EAINRIYEERNRQLSQHERVERVEDRTIKGRNGDIRVRVYQQK-------PDSPVLVYYH 86

Query: 80  GGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSWSALQWVASHS 139
           GGGF   S  S     L   +   +    +S++YRLAPEH  P A  D + A +WVA ++
Sbjct: 87  GGGFVICSIES--HDALCRRIARLSNSTVVSVDYRLAPEHKFPAAVYDCYDATKWVAENA 144

Query: 140 VNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTHP 199
                            D  ++FV GDSAG N+A  V + A      G   I    L +P
Sbjct: 145 EELRI------------DPSKIFVGGDSAGGNLAAAVSIMARDS---GEDFIKHQILIYP 189

Query: 200 YFWGSKPVG-SEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRL 258
                 P     +  +   +L   +  +         ++    + S     L        
Sbjct: 190 VVNFVAPTPSLLEFGEGLWILDQKIMSWFSEQYFSREEDKFNPLASVIFADLEN--LPPA 247

Query: 259 LVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLG 318
           L+  AE D LRD G ++   ++ +G E    +V+  G  H F       + AR  I ++ 
Sbjct: 248 LIITAEYDPLRDEGEVFGQMLRRAGVE--ASIVRYRGVLHGFINYYPVLKAARDAINQIA 305

Query: 319 SFVL 322
           + ++
Sbjct: 306 ALLV 309
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 308 Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Length = 358 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Length = 544 Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Length = 261 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Length = 517 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 100.0
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 100.0
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.95
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.95
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.95
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.94
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.93
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.9
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.88
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.88
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.88
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.86
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.86
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.85
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.84
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.84
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.83
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.82
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.82
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.81
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.8
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.79
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.79
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.79
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.78
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.77
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.77
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.77
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.77
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.76
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.75
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.74
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.74
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.74
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.73
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.72
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.72
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.71
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.7
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.7
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.69
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.69
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.69
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.68
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.68
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.66
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.66
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.66
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.66
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.66
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.65
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.65
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.65
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.65
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.65
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.65
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.65
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.64
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.63
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.62
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.62
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.62
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.6
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.6
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.6
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.59
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.58
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.58
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.56
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.52
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.46
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.45
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.41
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.38
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.38
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.16
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.14
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.14
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.08
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.92
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.89
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.88
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.85
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.83
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.82
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.79
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.73
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.71
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.47
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.34
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.17
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.59
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 96.36
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 95.92
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 95.29
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 95.28
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 94.91
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 94.91
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 94.52
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 94.41
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 93.93
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 93.56
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 91.8
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 90.89
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase
domain: Carboxylesterase
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=100.00  E-value=2.1e-36  Score=268.66  Aligned_cols=251  Identities=30%  Similarity=0.388  Sum_probs=200.0

Q ss_pred             CcceeeEecCCC-CceEEEEeccCCCCCCCCCCCcEEEEEcCCcccccCCcchhHHHHHHHHHHhCCcEEEEeecccCCC
Q 020576           40 GVSSKDITISEN-PKISARVYLPKLAQPISTQKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPE  118 (324)
Q Consensus        40 ~~~~~~v~~~~~-~~~~~~ly~P~~~~~~~~~~~pvvv~iHGgg~~~~~~~~~~~~~~~~~~~~~~g~~v~~~dyr~~~~  118 (324)
                      ...+++++++.. +.+.+++|.|++       +.|+|||+|||||..|+...  +..++..++++.|+.|+++|||++++
T Consensus        53 ~~~~~~~~i~~~~g~i~~~iy~P~~-------~~P~il~iHGGg~~~g~~~~--~~~~~~~l~~~~g~~Vv~v~Yrlap~  123 (311)
T d1jjia_          53 VERVEDRTIKGRNGDIRVRVYQQKP-------DSPVLVYYHGGGFVICSIES--HDALCRRIARLSNSTVVSVDYRLAPE  123 (311)
T ss_dssp             CSEEEEEEEEETTEEEEEEEEESSS-------SEEEEEEECCSTTTSCCTGG--GHHHHHHHHHHHTSEEEEEECCCTTT
T ss_pred             cceEEEEEEeCCCCcEEEEEEcCCC-------CceEEEEEcCCCCccCChhh--hhhhhhhhhhcCCcEEEEeccccccc
Confidence            345677777653 369999999964       35999999999999998864  67788888888899999999999999


Q ss_pred             CCCCcchHHHHHHHHHHHHhccCCCCCCCCCcccccCCCCCcEEEEecCchhHHHHHHHHHhhcccccCccceeEEEeec
Q 020576          119 HPLPIAYEDSWSALQWVASHSVNNGGFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGGVKILGAFLTH  198 (324)
Q Consensus       119 ~~~~~~~~D~~~~~~~l~~~~~~~~~~~~~~~~~~~~~d~~~i~l~G~S~GG~~a~~~~~~~~~~~~~~~~~~~~~i~~~  198 (324)
                      +.++..++|+.++++|+.++.         +++   ++|++||+|+|+|+||++++.++....+...   ..+.++++++
T Consensus       124 ~~~p~~~~d~~~a~~~~~~~~---------~~~---~~d~~ri~v~G~SaGG~la~~~~~~~~~~~~---~~~~~~~l~~  188 (311)
T d1jjia_         124 HKFPAAVYDCYDATKWVAENA---------EEL---RIDPSKIFVGGDSAGGNLAAAVSIMARDSGE---DFIKHQILIY  188 (311)
T ss_dssp             SCTTHHHHHHHHHHHHHHHTH---------HHH---TEEEEEEEEEEETHHHHHHHHHHHHHHHTTC---CCEEEEEEES
T ss_pred             cccchhhhhhhhhhhHHHHhH---------HHh---CcChhHEEEEeeecCCcceeechhhhhhccc---cccceeeeec
Confidence            999999999999999999987         566   7899999999999999999988877665432   2478999999


Q ss_pred             cccCCCCCCCCCCcc-----cccccchHHHHHhhcCCCCCCCCCCcccccCCCccccccCCCCcEEEEEcCccchhhcHH
Q 020576          199 PYFWGSKPVGSEDTR-----DFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAPTLAQLGCRRLLVSVAELDVLRDRGI  273 (324)
Q Consensus       199 p~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~lii~G~~D~~~~~~~  273 (324)
                      |+++...........     ..........+..+.... ....+...+|+..   .++++|  |++|+||+.|.+++++.
T Consensus       189 p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~sp~~~---~~~~~p--P~li~~g~~D~l~d~~~  262 (311)
T d1jjia_         189 PVVNFVAPTPSLLEFGEGLWILDQKIMSWFSEQYFSRE-EDKFNPLASVIFA---DLENLP--PALIITAEYDPLRDEGE  262 (311)
T ss_dssp             CCCCSSSCCHHHHHTSSSCSSCCHHHHHHHHHHHCSSG-GGGGCTTTSGGGS---CCTTCC--CEEEEEEEECTTHHHHH
T ss_pred             ceeeeccCcccccccccccccccHHHhhhhhhhccccc-ccccccccchhhc---ccccCC--CEEEEEcCCCCChHHHH
Confidence            998764332111100     001122233333444333 3444566777765   677888  99999999999999999


Q ss_pred             HHHHHHHhCCCCcceEEEEeCCCcccccccCcchHHHHHHHHHHHHHHH
Q 020576          274 LYYNAVKESGWEGEVELVQVEGEDHAFHILKYETENARKMIKRLGSFVL  322 (324)
Q Consensus       274 ~~~~~l~~~g~~~~~~~~~~~~~~H~~~~~~~~~~~~~~~~~~i~~fl~  322 (324)
                      .|+++|+++|+  ++++++++|++|+|....+..++++++++++.+||.
T Consensus       263 ~~~~~L~~~Gv--~v~~~~~~g~~H~F~~~~~~~~~a~~a~~~i~~fl~  309 (311)
T d1jjia_         263 VFGQMLRRAGV--EASIVRYRGVLHGFINYYPVLKAARDAINQIAALLV  309 (311)
T ss_dssp             HHHHHHHHTTC--CEEEEEEEEEETTGGGGTTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCC--CEEEEEECCCCCccccCCCcCHHHHHHHHHHHHHhC
Confidence            99999999999  999999999999998877788999999999999985
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure