BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020583
         (324 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q28EH9|T194A_XENTR Transmembrane protein 194A OS=Xenopus tropicalis GN=tmem194a PE=2
           SV=1
          Length = 431

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 248 LVRKHGLEISQPGLEPNKGLTWQMTKRRGDREVHKETEEKPGWCSNPHLPPCAAFVEIMA 307
           L RK  L+  +P   P + LT +  +++GD E  K  EE  G+CS+P          I +
Sbjct: 315 LYRKIKLKRGKPS--PPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQS 372

Query: 308 P 308
           P
Sbjct: 373 P 373


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.320    0.135    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 125,126,257
Number of Sequences: 539616
Number of extensions: 5328814
Number of successful extensions: 11393
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 11393
Number of HSP's gapped (non-prelim): 7
length of query: 324
length of database: 191,569,459
effective HSP length: 118
effective length of query: 206
effective length of database: 127,894,771
effective search space: 26346322826
effective search space used: 26346322826
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)