BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020583
(324 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q28EH9|T194A_XENTR Transmembrane protein 194A OS=Xenopus tropicalis GN=tmem194a PE=2
SV=1
Length = 431
Score = 34.3 bits (77), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%)
Query: 248 LVRKHGLEISQPGLEPNKGLTWQMTKRRGDREVHKETEEKPGWCSNPHLPPCAAFVEIMA 307
L RK L+ +P P + LT + +++GD E K EE G+CS+P I +
Sbjct: 315 LYRKIKLKRGKPS--PPRLLTEEEYRKQGDVETRKALEELRGYCSSPDFAAWKTVSRIQS 372
Query: 308 P 308
P
Sbjct: 373 P 373
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.320 0.135 0.428
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 125,126,257
Number of Sequences: 539616
Number of extensions: 5328814
Number of successful extensions: 11393
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 11393
Number of HSP's gapped (non-prelim): 7
length of query: 324
length of database: 191,569,459
effective HSP length: 118
effective length of query: 206
effective length of database: 127,894,771
effective search space: 26346322826
effective search space used: 26346322826
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)