Citrus Sinensis ID: 020594
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 324 | ||||||
| 297746227 | 494 | unnamed protein product [Vitis vinifera] | 0.996 | 0.653 | 0.842 | 1e-161 | |
| 225435253 | 433 | PREDICTED: general transcription factor | 0.996 | 0.745 | 0.842 | 1e-161 | |
| 224119296 | 412 | predicted protein [Populus trichocarpa] | 0.975 | 0.766 | 0.851 | 1e-158 | |
| 356571915 | 420 | PREDICTED: general transcription factor | 0.993 | 0.766 | 0.798 | 1e-156 | |
| 357509341 | 426 | General transcription factor IIH subunit | 0.984 | 0.748 | 0.795 | 1e-154 | |
| 356538258 | 419 | PREDICTED: general transcription factor | 0.981 | 0.758 | 0.784 | 1e-153 | |
| 449451946 | 423 | PREDICTED: general transcription factor | 0.996 | 0.763 | 0.784 | 1e-152 | |
| 449525401 | 329 | PREDICTED: general transcription factor | 0.996 | 0.981 | 0.784 | 1e-151 | |
| 297848764 | 421 | ATGTF2H2/GTF2H2 [Arabidopsis lyrata subs | 0.966 | 0.743 | 0.802 | 1e-148 | |
| 30679101 | 421 | transcription initiation factor TFIIH su | 0.966 | 0.743 | 0.799 | 1e-147 |
| >gi|297746227|emb|CBI16283.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 573 bits (1477), Expect = e-161, Method: Compositional matrix adjust.
Identities = 272/323 (84%), Positives = 294/323 (91%)
Query: 1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
MDF+PSRMAVVAK +EAF+REFFDQNPLSQIGLVT+KDG+A CLTDLGGSP+SH+KALMG
Sbjct: 171 MDFKPSRMAVVAKHIEAFIREFFDQNPLSQIGLVTIKDGLAQCLTDLGGSPDSHVKALMG 230
Query: 61 KLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIR 120
KL CSGDSSLQNALDLV G L+QIPSYGHREVLILYSALSTCDPGDIMETIQ+CK+SKIR
Sbjct: 231 KLECSGDSSLQNALDLVHGYLNQIPSYGHREVLILYSALSTCDPGDIMETIQECKKSKIR 290
Query: 121 CSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGF 180
CSVIGLSAE+FIC+HLCQ+TGGSYSVALDESHFKEL++EHAPPPPAIAEFAIANLIKMGF
Sbjct: 291 CSVIGLSAEIFICRHLCQETGGSYSVALDESHFKELLLEHAPPPPAIAEFAIANLIKMGF 350
Query: 181 PQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL 240
PQRA EG ISICSCHKE KVG GYTCPRCKARVCELPT+CRICGL LVSSPHLARSYHHL
Sbjct: 351 PQRAAEGVISICSCHKEAKVGGGYTCPRCKARVCELPTECRICGLTLVSSPHLARSYHHL 410
Query: 241 FPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYI 300
FPI PFDEV+ LN+P RS CFGCQ+SLL GNKP L VACPKCK+HFCL+CDIYI
Sbjct: 411 FPIPPFDEVSLSLLNNPHQRSSRACFGCQESLLIPGNKPTLCVACPKCKQHFCLDCDIYI 470
Query: 301 HESLHNCPGCESLRHSNPIVANE 323
HESLHNCPGCES RHS + E
Sbjct: 471 HESLHNCPGCESFRHSKIVSVTE 493
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225435253|ref|XP_002284994.1| PREDICTED: general transcription factor IIH subunit 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224119296|ref|XP_002331276.1| predicted protein [Populus trichocarpa] gi|222873701|gb|EEF10832.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356571915|ref|XP_003554116.1| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357509341|ref|XP_003624959.1| General transcription factor IIH subunit [Medicago truncatula] gi|355499974|gb|AES81177.1| General transcription factor IIH subunit [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356538258|ref|XP_003537621.1| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449451946|ref|XP_004143721.1| PREDICTED: general transcription factor IIH subunit 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449525401|ref|XP_004169706.1| PREDICTED: general transcription factor IIH subunit 2-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297848764|ref|XP_002892263.1| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata] gi|297338105|gb|EFH68522.1| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30679101|ref|NP_683275.2| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana] gi|22087278|gb|AAM90909.1|AF499443_1 p44/SSL1-like protein [Arabidopsis thaliana] gi|4056421|gb|AAC97995.1| Similar to gb|Z30094 basic transcripion factor 2, 44 kD subunit from Homo sapiens. EST gb|W43325 comes from this gene [Arabidopsis thaliana] gi|110738828|dbj|BAF01337.1| putative transcription factor [Arabidopsis thaliana] gi|332189663|gb|AEE27784.1| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 324 | ||||||
| TAIR|locus:504956103 | 421 | GTF2H2 "general transcription | 0.984 | 0.757 | 0.743 | 2.7e-132 | |
| DICTYBASE|DDB_G0272362 | 461 | gtf2h2 "TFIIH subunit" [Dictyo | 0.941 | 0.661 | 0.454 | 8.4e-74 | |
| UNIPROTKB|E2R345 | 395 | GTF2H2 "Uncharacterized protei | 0.919 | 0.754 | 0.447 | 1.3e-70 | |
| SGD|S000003995 | 461 | SSL1 "Subunit of the core form | 0.941 | 0.661 | 0.448 | 4.3e-70 | |
| UNIPROTKB|I3LKI8 | 395 | GTF2H2 "Uncharacterized protei | 0.919 | 0.754 | 0.440 | 8.9e-70 | |
| UNIPROTKB|F5GZM1 | 338 | GTF2H2C "General transcription | 0.919 | 0.881 | 0.444 | 2.4e-69 | |
| UNIPROTKB|J3KQC7 | 338 | GTF2H2 "General transcription | 0.919 | 0.881 | 0.444 | 2.4e-69 | |
| UNIPROTKB|Q13888 | 395 | GTF2H2 "General transcription | 0.919 | 0.754 | 0.444 | 2.4e-69 | |
| UNIPROTKB|Q6P1K8 | 395 | GTF2H2C "General transcription | 0.919 | 0.754 | 0.444 | 2.4e-69 | |
| POMBASE|SPCC1682.07 | 421 | ssl1 "transcription factor TFI | 0.938 | 0.722 | 0.429 | 2.4e-69 |
| TAIR|locus:504956103 GTF2H2 "general transcription factor II H2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1297 (461.6 bits), Expect = 2.7e-132, P = 2.7e-132
Identities = 238/320 (74%), Positives = 269/320 (84%)
Query: 1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
MDFRPSRMA++AK VEAF+REFFDQNPLSQIGLV++K+GVA+ LTDLGGSPE+HIKALMG
Sbjct: 97 MDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMG 156
Query: 61 KLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIR 120
KL GDSSLQNAL+LV L+Q+PSYGHREVLILYSAL TCDPGDIMETIQKCK+SK+R
Sbjct: 157 KLEALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLR 216
Query: 121 CSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHXXXXXXXXXXXXXNLIKMGF 180
CSVIGLSAEMFICKHLCQ+TGG YSVA+DE H K+L++EH NLIKMGF
Sbjct: 217 CSVIGLSAEMFICKHLCQETGGLYSVAVDEVHLKDLLLEHAPPPPAIAEFAIANLIKMGF 276
Query: 181 PQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL 240
PQRA EGS++ICSCHKEVK+G GY CPRCKARVC+LPT+C ICGL LVSSPHLARSYHHL
Sbjct: 277 PQRAAEGSMAICSCHKEVKIGAGYMCPRCKARVCDLPTECTICGLTLVSSPHLARSYHHL 336
Query: 241 FPIAPFDEVTPLC-LNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIY 299
FPIAPFDEV L LND R + +CFGCQQSL+ +GNKP V C KCK +FCL+CDIY
Sbjct: 337 FPIAPFDEVPALSSLNDNRRKLGKSCFGCQQSLIGAGNKPVPCVTCRKCKHYFCLDCDIY 396
Query: 300 IHESLHNCPGCESLRHSNPI 319
IHESLHNCPGCES+ +
Sbjct: 397 IHESLHNCPGCESIHRPKSV 416
|
|
| DICTYBASE|DDB_G0272362 gtf2h2 "TFIIH subunit" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R345 GTF2H2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| SGD|S000003995 SSL1 "Subunit of the core form of RNA polymerase transcription factor TFIIH" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LKI8 GTF2H2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GZM1 GTF2H2C "General transcription factor IIH subunit 2-like protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KQC7 GTF2H2 "General transcription factor IIH subunit 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13888 GTF2H2 "General transcription factor IIH subunit 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P1K8 GTF2H2C "General transcription factor IIH subunit 2-like protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1682.07 ssl1 "transcription factor TFIIH complex subunit Ssl1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 324 | |||
| pfam04056 | 193 | pfam04056, Ssl1, Ssl1-like | 1e-102 | |
| COG5151 | 421 | COG5151, SSL1, RNA polymerase II transcription ini | 1e-102 | |
| cd01453 | 183 | cd01453, vWA_transcription_factor_IIH_type, Transc | 6e-90 | |
| TIGR00622 | 112 | TIGR00622, ssl1, transcription factor ssl1 | 3e-34 | |
| pfam07975 | 48 | pfam07975, C1_4, TFIIH C1-like domain | 2e-18 | |
| smart01047 | 49 | smart01047, C1_4, TFIIH C1-like domain | 3e-15 | |
| smart00327 | 175 | smart00327, VWA, von Willebrand factor (vWF) type | 8e-15 | |
| cd00198 | 161 | cd00198, vWFA, Von Willebrand factor type A (vWA) | 1e-09 | |
| pfam13519 | 172 | pfam13519, VWA_2, von Willebrand factor type A dom | 3e-08 | |
| COG5242 | 296 | COG5242, TFB4, RNA polymerase II transcription ini | 0.003 |
| >gnl|CDD|190848 pfam04056, Ssl1, Ssl1-like | Back alignment and domain information |
|---|
Score = 298 bits (766), Expect = e-102
Identities = 114/183 (62%), Positives = 134/183 (73%), Gaps = 2/183 (1%)
Query: 1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
D RPSR A K +E FV EFFDQNP+SQIGL+T KDG A+ LTDL G+P HIKAL
Sbjct: 11 KDLRPSRFACTIKYLETFVEEFFDQNPISQIGLITCKDGRAHRLTDLTGNPRVHIKALKS 70
Query: 61 KLG--CSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESK 118
C GD SLQNAL+L + L +PS+G REVLI++ +LSTCDPGDI TI K+ K
Sbjct: 71 LREAECGGDPSLQNALELARASLKHVPSHGSREVLIIFGSLSTCDPGDIYSTIDTLKKEK 130
Query: 119 IRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKM 178
IRCSVIGLSAE+FICK LC+ T G+YSVALDE+H KEL++EH PPPA A+LIKM
Sbjct: 131 IRCSVIGLSAEVFICKELCKATNGTYSVALDETHLKELLLEHVLPPPAAKSSTEASLIKM 190
Query: 179 GFP 181
GFP
Sbjct: 191 GFP 193
|
Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex. Length = 193 |
| >gnl|CDD|227480 COG5151, SSL1, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238730 cd01453, vWA_transcription_factor_IIH_type, Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >gnl|CDD|129709 TIGR00622, ssl1, transcription factor ssl1 | Back alignment and domain information |
|---|
| >gnl|CDD|116585 pfam07975, C1_4, TFIIH C1-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214993 smart01047, C1_4, TFIIH C1-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >gnl|CDD|222192 pfam13519, VWA_2, von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >gnl|CDD|227567 COG5242, TFB4, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 324 | |||
| KOG2807 | 378 | consensus RNA polymerase II transcription initiati | 100.0 | |
| COG5151 | 421 | SSL1 RNA polymerase II transcription initiation/nu | 100.0 | |
| PF04056 | 193 | Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro | 100.0 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 100.0 | |
| TIGR00627 | 279 | tfb4 transcription factor tfb4. This family is bas | 100.0 | |
| PF03850 | 276 | Tfb4: Transcription factor Tfb4; InterPro: IPR0046 | 100.0 | |
| cd01453 | 183 | vWA_transcription_factor_IIH_type Transcription fa | 100.0 | |
| KOG2487 | 314 | consensus RNA polymerase II transcription initiati | 100.0 | |
| cd01452 | 187 | VWA_26S_proteasome_subunit 26S proteasome plays a | 99.97 | |
| COG5242 | 296 | TFB4 RNA polymerase II transcription initiation/nu | 99.95 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 99.86 | |
| KOG2884 | 259 | consensus 26S proteasome regulatory complex, subun | 99.84 | |
| PRK13685 | 326 | hypothetical protein; Provisional | 99.77 | |
| COG5148 | 243 | RPN10 26S proteasome regulatory complex, subunit R | 99.75 | |
| cd01455 | 191 | vWA_F11C1-5a_type Von Willebrand factor type A (vW | 99.7 | |
| PF13519 | 172 | VWA_2: von Willebrand factor type A domain; PDB: 3 | 99.62 | |
| cd01467 | 180 | vWA_BatA_type VWA BatA type: Von Willebrand factor | 99.61 | |
| TIGR03436 | 296 | acidobact_VWFA VWFA-related Acidobacterial domain. | 99.56 | |
| cd01451 | 178 | vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch | 99.51 | |
| cd01465 | 170 | vWA_subgroup VWA subgroup: Von Willebrand factor t | 99.48 | |
| cd01466 | 155 | vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact | 99.47 | |
| cd01472 | 164 | vWA_collagen von Willebrand factor (vWF) type A do | 99.44 | |
| cd01456 | 206 | vWA_ywmD_type VWA ywmD type:Von Willebrand factor | 99.44 | |
| cd01461 | 171 | vWA_interalpha_trypsin_inhibitor vWA_interalpha tr | 99.42 | |
| smart00327 | 177 | VWA von Willebrand factor (vWF) type A domain. VWA | 99.42 | |
| cd01480 | 186 | vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI | 99.41 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 99.41 | |
| cd01469 | 177 | vWA_integrins_alpha_subunit Integrins are a class | 99.4 | |
| cd01470 | 198 | vWA_complement_factors Complement factors B and C2 | 99.4 | |
| cd01450 | 161 | vWFA_subfamily_ECM Von Willebrand factor type A (v | 99.37 | |
| cd01474 | 185 | vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi | 99.36 | |
| cd01463 | 190 | vWA_VGCC_like VWA Voltage gated Calcium channel li | 99.32 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 99.31 | |
| cd01477 | 193 | vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand | 99.27 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 99.24 | |
| cd00198 | 161 | vWFA Von Willebrand factor type A (vWA) domain was | 99.23 | |
| cd01482 | 164 | vWA_collagen_alphaI-XII-like Collagen: The extrace | 99.22 | |
| cd01471 | 186 | vWA_micronemal_protein Micronemal proteins: The To | 99.12 | |
| PF00092 | 178 | VWA: von Willebrand factor type A domain; InterPro | 99.12 | |
| PTZ00441 | 576 | sporozoite surface protein 2 (SSP2); Provisional | 99.07 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.0 | |
| cd01473 | 192 | vWA_CTRP CTRP for CS protein-TRAP-related protein: | 98.99 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 98.97 | |
| cd01476 | 163 | VWA_integrin_invertebrates VWA_integrin (invertebr | 98.95 | |
| PF13768 | 155 | VWA_3: von Willebrand factor type A domain | 98.93 | |
| cd01458 | 218 | vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter | 98.93 | |
| TIGR03788 | 596 | marine_srt_targ marine proteobacterial sortase tar | 98.92 | |
| COG1240 | 261 | ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis | 98.83 | |
| cd01481 | 165 | vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V | 98.76 | |
| cd01454 | 174 | vWA_norD_type norD type: Denitrifying bacteria con | 98.74 | |
| cd01460 | 266 | vWA_midasin VWA_Midasin: Midasin is a member of th | 98.73 | |
| cd01464 | 176 | vWA_subfamily VWA subfamily: Von Willebrand factor | 98.69 | |
| cd01462 | 152 | VWA_YIEM_type VWA YIEM type: Von Willebrand factor | 98.64 | |
| cd01457 | 199 | vWA_ORF176_type VWA ORF176 type: Von Willebrand fa | 98.23 | |
| cd01479 | 244 | Sec24-like Sec24-like: Protein and membrane traffi | 97.99 | |
| PF04811 | 243 | Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I | 97.95 | |
| cd01468 | 239 | trunk_domain trunk domain. COPII-coated vesicles c | 97.86 | |
| cd01478 | 267 | Sec23-like Sec23-like: Protein and membrane traffi | 97.63 | |
| PLN00162 | 761 | transport protein sec23; Provisional | 97.44 | |
| PF03731 | 224 | Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte | 97.4 | |
| COG4245 | 207 | TerY Uncharacterized protein encoded in toxicity p | 96.98 | |
| PF10138 | 200 | vWA-TerF-like: vWA found in TerF C terminus ; Inte | 96.9 | |
| TIGR00578 | 584 | ku70 ATP-dependent DNA helicase ii, 70 kDa subunit | 96.38 | |
| KOG1984 | 1007 | consensus Vesicle coat complex COPII, subunit SFB3 | 96.18 | |
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 96.08 | |
| PRK10997 | 487 | yieM hypothetical protein; Provisional | 96.07 | |
| PF11265 | 226 | Med25_VWA: Mediator complex subunit 25 von Willebr | 95.89 | |
| KOG1986 | 745 | consensus Vesicle coat complex COPII, subunit SEC2 | 95.87 | |
| PF05762 | 222 | VWA_CoxE: VWA domain containing CoxE-like protein; | 94.77 | |
| COG2304 | 399 | Uncharacterized protein containing a von Willebran | 93.88 | |
| PF07002 | 146 | Copine: Copine; InterPro: IPR010734 This represent | 93.74 | |
| COG2425 | 437 | Uncharacterized protein containing a von Willebran | 93.71 | |
| COG4867 | 652 | Uncharacterized protein with a von Willebrand fact | 93.7 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 93.26 | |
| COG5028 | 861 | Vesicle coat complex COPII, subunit SEC24/subunit | 92.82 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 92.76 | |
| smart00187 | 423 | INB Integrin beta subunits (N-terminal portion of | 92.09 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 91.76 | |
| PF06707 | 205 | DUF1194: Protein of unknown function (DUF1194); In | 91.51 | |
| cd01459 | 254 | vWA_copine_like VWA Copine: Copines are phospholip | 91.17 | |
| TIGR00288 | 160 | conserved hypothetical protein TIGR00288. This fam | 91.11 | |
| KOG2462 | 279 | consensus C2H2-type Zn-finger protein [Transcripti | 89.8 | |
| KOG1985 | 887 | consensus Vesicle coat complex COPII, subunit SEC2 | 89.51 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 88.61 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 88.09 | |
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 87.8 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 87.05 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 86.31 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 84.4 | |
| PRK12496 | 164 | hypothetical protein; Provisional | 83.83 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 82.28 | |
| cd06167 | 149 | LabA_like LabA_like proteins. A well conserved gro | 81.94 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 81.9 | |
| cd02340 | 43 | ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre | 81.4 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 81.29 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 80.79 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 80.58 |
| >KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-107 Score=760.01 Aligned_cols=302 Identities=60% Similarity=1.083 Sum_probs=287.5
Q ss_pred CCCCCcHHHHHHHHHHHHHHHHhcCCcCCceEEEEeeCCeeeEeecCCCCHHHHHHHHhhhcCCCCcchHHHHHHHHHHH
Q 020594 1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGL 80 (324)
Q Consensus 1 ~D~~P~Rl~~~~~~l~~Fv~~~f~qNP~sqlGiI~~~~g~a~~l~~lt~n~~~~~~~L~~~~~~~G~~sL~naL~~A~~~ 80 (324)
+||+|||+..+.++++.||.+||||||+||||||+++||+|++++.+|||++.|+++|+.+.++.|++||||||+||...
T Consensus 76 ~Df~P~r~a~~~K~le~Fv~eFFdQNPiSQigii~~k~g~A~~lt~ltgnp~~hI~aL~~~~~~~g~fSLqNaLe~a~~~ 155 (378)
T KOG2807|consen 76 KDFRPSRFANVIKYLEGFVPEFFDQNPISQIGIISIKDGKADRLTDLTGNPRIHIHALKGLTECSGDFSLQNALELAREV 155 (378)
T ss_pred ccCCchHHHHHHHHHHHHHHHHhccCchhheeEEEEecchhhHHHHhcCCHHHHHHHHhcccccCCChHHHHHHHHHHHH
Confidence 59999999999999999999999999999999999999999999999999999999999887899999999999999999
Q ss_pred hhCCCCCCCceEEEEEeCCCCCCcccHHHHHHHHHhcCcEEEEEEccchHHHHHHHHHhhCCeeEEeCCHHHHHHHHHhc
Q 020594 81 LSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEH 160 (324)
Q Consensus 81 L~~~p~~~~reILil~gS~~t~d~g~i~~ti~~akk~~IrV~vI~Lgae~~iLk~ia~~TgG~Y~va~d~~hl~~lL~~~ 160 (324)
|+++|+|.+||||||+||+.|+|||||++||+++|+.+|||++|||+||+.|+|++|+.|||.|.|++|++||++||.++
T Consensus 156 Lk~~p~H~sREVLii~sslsT~DPgdi~~tI~~lk~~kIRvsvIgLsaEv~icK~l~kaT~G~Y~V~lDe~HlkeLl~e~ 235 (378)
T KOG2807|consen 156 LKHMPGHVSREVLIIFSSLSTCDPGDIYETIDKLKAYKIRVSVIGLSAEVFICKELCKATGGRYSVALDEGHLKELLLEH 235 (378)
T ss_pred hcCCCcccceEEEEEEeeecccCcccHHHHHHHHHhhCeEEEEEeechhHHHHHHHHHhhCCeEEEEeCHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCccchhhhhhceeeecCCCCCCCCCccceeecCCccccCeeEcCCCCcccccCCCCCCCCCceecCchhHHhhhccc
Q 020594 161 APPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL 240 (324)
Q Consensus 161 ~~pp~~~~~~~~~~Li~mGfP~~~~~~~~a~C~CH~~~~~~~Gy~Cp~C~s~~C~lP~~C~~C~l~Lvs~~hLarsyhhl 240 (324)
+.|||+.+. .+.+|||||||++...+.+++|+||..++.. ||.||||++++|+||++||+|+|+||||||||||||||
T Consensus 236 ~~Pp~~~~~-~~~sLvkmGFP~~~~e~~ps~C~CH~~~~~~-Gy~CP~CkakvCsLP~eCpiC~ltLVss~hLARSyhhL 313 (378)
T KOG2807|consen 236 THPPPANKS-KECSLVKMGFPSRSPEDTPSFCACHSELSGG-GYFCPQCKAKVCSLPIECPICSLTLVSSPHLARSYHHL 313 (378)
T ss_pred CCCCCcccc-cCCceEEecCCCcccccCcchheeccccccC-ceeCCcccCeeecCCccCCccceeEecchHHHHHHHhh
Confidence 999998744 3899999999999999999999999888888 99999999999999999999999999999999999999
Q ss_pred CCCCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhhcCCCCCCCCCCC
Q 020594 241 FPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLR 314 (324)
Q Consensus 241 ~p~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCd~fihe~lh~CpgC~~~~ 314 (324)
|||++|+|++ |.+..+++.||+|+..+. ++.+|+|+.|+++||.|||+||||+||+||||+.++
T Consensus 314 ~PL~~F~Eip-----~~~~~~~~~Cf~C~~~~~-----~~~~y~C~~Ck~~FCldCDv~iHesLh~CpgCeh~~ 377 (378)
T KOG2807|consen 314 FPLKPFVEIP-----ETEYNGSRFCFACQGELL-----SSGRYRCESCKNVFCLDCDVFIHESLHNCPGCEHKP 377 (378)
T ss_pred cCCcchhhcc-----ccccCCCcceeeeccccC-----CCCcEEchhccceeeccchHHHHhhhhcCCCcCCCC
Confidence 9999999996 445567889999964443 346899999999999999999999999999999654
|
|
| >COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >TIGR00627 tfb4 transcription factor tfb4 | Back alignment and domain information |
|---|
| >PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >KOG2487 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins | Back alignment and domain information |
|---|
| >COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13685 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A | Back alignment and domain information |
|---|
| >cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain | Back alignment and domain information |
|---|
| >cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) | Back alignment and domain information |
|---|
| >cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins | Back alignment and domain information |
|---|
| >cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) | Back alignment and domain information |
|---|
| >smart00327 VWA von Willebrand factor (vWF) type A domain | Back alignment and domain information |
|---|
| >cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration | Back alignment and domain information |
|---|
| >cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation | Back alignment and domain information |
|---|
| >cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax | Back alignment and domain information |
|---|
| >cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >cd01477 vWA_F09G8-8_type VWA F09G8 | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell | Back alignment and domain information |
|---|
| >PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma | Back alignment and domain information |
|---|
| >PTZ00441 sporozoite surface protein 2 (SSP2); Provisional | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions | Back alignment and domain information |
|---|
| >PF13768 VWA_3: von Willebrand factor type A domain | Back alignment and domain information |
|---|
| >cd01458 vWA_ku Ku70/Ku80 N-terminal domain | Back alignment and domain information |
|---|
| >TIGR03788 marine_srt_targ marine proteobacterial sortase target protein | Back alignment and domain information |
|---|
| >COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions | Back alignment and domain information |
|---|
| >cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases | Back alignment and domain information |
|---|
| >cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family | Back alignment and domain information |
|---|
| >cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) | Back alignment and domain information |
|---|
| >cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] | Back alignment and domain information |
|---|
| >cd01468 trunk_domain trunk domain | Back alignment and domain information |
|---|
| >cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles | Back alignment and domain information |
|---|
| >PLN00162 transport protein sec23; Provisional | Back alignment and domain information |
|---|
| >PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway | Back alignment and domain information |
|---|
| >COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts | Back alignment and domain information |
|---|
| >TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) | Back alignment and domain information |
|---|
| >KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >PRK10997 yieM hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown | Back alignment and domain information |
|---|
| >COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines | Back alignment and domain information |
|---|
| >COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length | Back alignment and domain information |
|---|
| >cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium | Back alignment and domain information |
|---|
| >TIGR00288 conserved hypothetical protein TIGR00288 | Back alignment and domain information |
|---|
| >KOG2462 consensus C2H2-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PRK12496 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd06167 LabA_like LabA_like proteins | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >cd02340 ZZ_NBR1_like Zinc finger, ZZ type | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 324 | ||||
| 1z60_A | 59 | Solution Structure Of The Carboxy-Terminal Domain O | 4e-05 |
| >pdb|1Z60|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Human Tfiih P44 Subunit Length = 59 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 324 | |||
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 1e-37 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 6e-17 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 | Back alignment and structure |
|---|
Score = 132 bits (332), Expect = 1e-37
Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 13/181 (7%)
Query: 2 DFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGK 61
D+ P+R V + + NP + GL+T+ D L+ L + A+
Sbjct: 19 DYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAM-HD 77
Query: 62 LGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSA-LSTCDPGDIMETIQKCKESKIR 120
L G++ + + + Q L + R+ ++ + D +++ ++ K++ +
Sbjct: 78 LPVRGNAKFGDGIQIAQLALKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVA 137
Query: 121 CSVI--GLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKM 178
+I G +H S D H + P P +++ + I
Sbjct: 138 IDIIHIGELQNESALQHFIDAANSS-----DSCHLVSI----PPSPQLLSDLVNQSPIGQ 188
Query: 179 G 179
G
Sbjct: 189 G 189
|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Length = 59 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 324 | |||
| 2x5n_A | 192 | SPRPN10, 26S proteasome regulatory subunit RPN10; | 99.92 | |
| 4b4t_W | 268 | RPN10, 26S proteasome regulatory subunit RPN10; hy | 99.91 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 99.86 | |
| 3ibs_A | 218 | Conserved hypothetical protein BATB; structural ge | 99.72 | |
| 1q0p_A | 223 | Complement factor B; VON willebrand factor, MAC-1, | 99.6 | |
| 1shu_X | 182 | Anthrax toxin receptor 2; alpha/beta rossmann fold | 99.55 | |
| 1ijb_A | 202 | VON willebrand factor; dinucleotide-binding fold, | 99.54 | |
| 2b2x_A | 223 | Integrin alpha-1; computational design, antibody-a | 99.53 | |
| 1v7p_C | 200 | Integrin alpha-2; snake venom, C-type lectin, anta | 99.51 | |
| 1n3y_A | 198 | Integrin alpha-X; alpha/beta rossmann fold, cell a | 99.5 | |
| 1rrk_A | 497 | Complement factor B; BB, hydrolase; 2.00A {Homo sa | 99.5 | |
| 1atz_A | 189 | VON willebrand factor; collagen-binding, hemostasi | 99.49 | |
| 4hqo_A | 266 | Sporozoite surface protein 2; malaria, gliding mot | 99.48 | |
| 1mf7_A | 194 | Integrin alpha M; cell adhesion; 1.25A {Homo sapie | 99.47 | |
| 4hqf_A | 281 | Thrombospondin-related anonymous protein, trap; ma | 99.46 | |
| 1pt6_A | 213 | Integrin alpha-1; cell adhesion; 1.87A {Homo sapie | 99.45 | |
| 4fx5_A | 464 | VON willebrand factor type A; structural genomics, | 99.44 | |
| 1jey_B | 565 | KU80; double-strand DNA break repair, non-homologo | 99.41 | |
| 3n2n_F | 185 | Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho | 99.4 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.34 | |
| 2x31_A | 189 | Magnesium-chelatase 60 kDa subunit; ligase, bacter | 99.33 | |
| 2odp_A | 509 | Complement C2; C3/C5 convertase, complement serin | 99.32 | |
| 2xgg_A | 178 | Microneme protein 2; A/I domain, cell adhesion, hy | 99.26 | |
| 1mjn_A | 179 | Integrin alpha-L; rossmann fold, immune system; 1. | 99.12 | |
| 3zqk_A | 199 | VON willebrand factor; blood clotting, adamts-13, | 99.11 | |
| 3k6s_A | 1095 | Integrin alpha-X; cell receptor, adhesion molecule | 99.03 | |
| 1jey_A | 609 | KU70; double-strand DNA break repair, non-homologo | 98.99 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 98.41 | |
| 1yvr_A | 538 | RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, | 98.18 | |
| 2nvo_A | 535 | RO sixty-related protein, RSR; alpha helical repea | 98.0 | |
| 2nut_A | 769 | Protein transport protein SEC23A; human copii SEC2 | 97.94 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 97.66 | |
| 2ww8_A | 893 | RRGA, cell WALL surface anchor family protein; IGG | 97.51 | |
| 1m2o_A | 768 | SEC23, protein transport protein SEC23, SEC23P; zi | 97.43 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 97.41 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 97.17 | |
| 2iue_A | 212 | Pactolus I-domain; membrane protein, CD, ITC, limb | 96.92 | |
| 3rag_A | 242 | Uncharacterized protein; structural genomics, PSI- | 96.72 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 96.51 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 96.48 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 95.45 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 93.93 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 92.47 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 92.03 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 91.92 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 91.39 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 91.3 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 91.18 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 91.13 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 90.82 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 90.46 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 90.26 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 90.01 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 89.85 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 89.62 | |
| 3t3p_B | 472 | Integrin beta-3; integrin, cell adhesion, blood cl | 89.57 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 89.31 | |
| 3vi3_B | 454 | Integrin beta-1; beta propeller fold, rossman fold | 89.21 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 89.13 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 88.44 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 88.05 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 87.87 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 87.82 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 87.82 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 87.63 | |
| 1wg2_A | 64 | Zinc finger (AN1-like) family protein; riken struc | 86.94 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 86.83 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 86.51 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 86.3 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 86.26 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 85.97 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 85.55 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 85.51 | |
| 1wff_A | 85 | Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc | 84.88 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 84.76 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 84.67 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 84.62 | |
| 1wfp_A | 74 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 84.48 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 84.02 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 82.93 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 82.82 | |
| 3v4v_B | 503 | Integrin beta-7; cell adhesion, madcam-1, membrane | 82.81 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 82.6 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 82.29 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 82.03 | |
| 2v3b_B | 55 | Rubredoxin 2, rubredoxin; alkane degradation, iron | 81.91 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 81.81 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 81.79 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 81.5 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 81.31 | |
| 1wfh_A | 64 | Zinc finger (AN1-like) family protein; ZF-AN1 doma | 81.17 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 80.6 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 80.45 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 80.23 |
| >2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
Probab=99.92 E-value=1.5e-24 Score=193.31 Aligned_cols=139 Identities=15% Similarity=0.271 Sum_probs=125.3
Q ss_pred CCCCCcHHHHHHHHHHHHHHHHhcCCcCCceEEEEeeCCeeeEeecCCCCHHHHHHHHhhhcCCCCcchHHHHHHHHHHH
Q 020594 1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGL 80 (324)
Q Consensus 1 ~D~~P~Rl~~~~~~l~~Fv~~~f~qNP~sqlGiI~~~~g~a~~l~~lt~n~~~~~~~L~~~~~~~G~~sL~naL~~A~~~ 80 (324)
+||.||||+++++++..|+++|+++||.+++|||+|+++.+++++|+|.|++.+.+.|+++ .+.|+++|++||++|...
T Consensus 18 ~D~~psRl~~ak~~~~~~~~~~~~~~~~d~vGLV~fa~~~a~~~~plT~d~~~i~~~L~~l-~~~g~t~l~~aL~~A~~~ 96 (192)
T 2x5n_A 18 GDYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAMHDL-PVRGNAKFGDGIQIAQLA 96 (192)
T ss_dssp TTSSSCHHHHHHHHHHHHHHHHHHHCTTCEEEEEECCTTSCCEEEEEESCHHHHHHHHTTC-CCCSCCCHHHHHHHHHHH
T ss_pred CCCCCCHHHHHHHHHHHHHHHHHhcCCCCeEEEEEEcCCCcEEecCCCCCHHHHHHHHHcC-CCCCCchHHHHHHHHHHH
Confidence 5999999999999999999999999999999999998657999999999999999999985 677889999999999999
Q ss_pred hhCCCCCCCc-eEEEEEeCCCCCCcccHHHHHHHHHhcCcEEEEEEccchH---HHHHHHHHhhC
Q 020594 81 LSQIPSYGHR-EVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEM---FICKHLCQDTG 141 (324)
Q Consensus 81 L~~~p~~~~r-eILil~gS~~t~d~g~i~~ti~~akk~~IrV~vI~Lgae~---~iLk~ia~~Tg 141 (324)
|++.+.+..+ |||||++++.+.|++++.++++.+|++||+|++|++|.+. . |+++++.++
T Consensus 97 l~~~~~~~~~~riiil~~~~~~~~~~~~~~~a~~lk~~gi~v~~Ig~G~~~~~~~-l~~la~~~n 160 (192)
T 2x5n_A 97 LKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVAIDIIHIGELQNESA-LQHFIDAAN 160 (192)
T ss_dssp HHTCSCTTSEEEEEEEECSCCSSCHHHHHHHHHHHHHTTEEEEEEEESCC---CH-HHHHHHHHC
T ss_pred HHhccccCCCceEEEEEECCCCCCchhHHHHHHHHHHCCCEEEEEEeCCCCccHH-HHHHHHhcc
Confidence 9998765544 5777776666778899999999999999999999999875 6 999999976
|
| >4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* | Back alignment and structure |
|---|
| >1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C | Back alignment and structure |
|---|
| >2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A | Back alignment and structure |
|---|
| >1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A | Back alignment and structure |
|---|
| >1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A | Back alignment and structure |
|---|
| >4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* | Back alignment and structure |
|---|
| >1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G | Back alignment and structure |
|---|
| >4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A | Back alignment and structure |
|---|
| >1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A | Back alignment and structure |
|---|
| >4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* | Back alignment and structure |
|---|
| >3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* | Back alignment and structure |
|---|
| >2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... | Back alignment and structure |
|---|
| >3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* | Back alignment and structure |
|---|
| >3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* | Back alignment and structure |
|---|
| >1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A | Back alignment and structure |
|---|
| >2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A | Back alignment and structure |
|---|
| >2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 324 | ||||
| d1z60a1 | 59 | g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-ri | 1e-16 | |
| d1jeyb2 | 236 | c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain | 7e-04 |
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
class: Small proteins fold: Cysteine-rich domain superfamily: Cysteine-rich domain family: TFIIH p44 subunit cysteine-rich domain domain: TFIIH p44 subunit cysteine-rich domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 70.6 bits (173), Expect = 1e-16
Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 10/68 (14%)
Query: 243 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHE 302
+ F E+ N R C+GCQ L C C+ FC++CD+++H+
Sbjct: 1 LDAFQEIPLEEYNGERF-----CYGCQGELKDQH-----VYVCAVCQNVFCVDCDVFVHD 50
Query: 303 SLHNCPGC 310
SLH+CPGC
Sbjct: 51 SLHSCPGC 58
|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 324 | |||
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 99.87 | |
| d1shux_ | 181 | Capillary morphogenesis protein 2 domain {Human (H | 99.28 | |
| d1atza_ | 184 | von Willebrand factor A3 domain, vWA3 {Human (Homo | 99.28 | |
| d1jeyb2 | 236 | Ku80 subunit N-terminal domain {Human (Homo sapien | 99.26 | |
| d1v7pc_ | 193 | Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId | 99.2 | |
| d1pt6a_ | 192 | Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId | 99.15 | |
| d1q0pa_ | 209 | Complement factor B domain {Human (Homo sapiens) [ | 99.15 | |
| d1ijba_ | 202 | von Willebrand factor A1 domain, vWA1 {Human (Homo | 99.14 | |
| d1jeya2 | 220 | Ku70 subunit N-terminal domain {Human (Homo sapien | 99.14 | |
| d1n3ya_ | 189 | Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI | 99.07 | |
| d1mf7a_ | 194 | Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub | 99.04 | |
| d1mjna_ | 179 | Integrin CD11a/CD18 (Leukocyte function associated | 98.47 | |
| d1pd0a3 | 252 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 98.22 | |
| d1tyeb2 | 248 | Integrin beta A domain {Human (Homo sapiens) [TaxI | 98.14 | |
| d2qtva3 | 271 | Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T | 98.07 | |
| d1yvra2 | 174 | 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c | 97.28 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 94.02 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 92.94 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 91.85 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 90.56 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 90.55 | |
| d1wfka_ | 88 | Zinc finger FYVE domain containing protein 19 {Mou | 90.42 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 90.09 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 89.39 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 88.93 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 87.97 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 87.27 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 86.36 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 82.73 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 82.26 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 82.21 |
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Cysteine-rich domain superfamily: Cysteine-rich domain family: TFIIH p44 subunit cysteine-rich domain domain: TFIIH p44 subunit cysteine-rich domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=2.1e-24 Score=153.66 Aligned_cols=59 Identities=36% Similarity=0.975 Sum_probs=51.2
Q ss_pred CCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhhcCCCCCCCC
Q 020594 243 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCE 311 (324)
Q Consensus 243 ~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCd~fihe~lh~CpgC~ 311 (324)
|++|+||+++ +..+++.||||+++|++ +++|+|++|+++||+|||+||||+|||||||.
T Consensus 1 L~~F~EVp~~-----~~~~~~~C~gC~~~l~~-----~~~y~C~~C~~~FC~dCD~fiHe~lh~CpgCl 59 (59)
T d1z60a1 1 LDAFQEIPLE-----EYNGERFCYGCQGELKD-----QHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI 59 (59)
T ss_dssp CCSCCEEEHH-----HHCSCCEETTTTEECTT-----SEEECCTTTTCCBCHHHHHTTTTTSCSSSTTC
T ss_pred CCCcceeehh-----hcCCCCCccCCCCcCCC-----CceEECcCCCCccccccchhhhhhhcCCCCCC
Confidence 6899999753 33467899999998863 36899999999999999999999999999995
|
| >d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|