Citrus Sinensis ID: 020594


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG
ccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHHHccEEEEEEEcccHHHHHHHHHHcccccEEEEcccHHHHHHHHHcccccHHcccccccccEEEcccccccccccccEEEccccccccEEEccccccEEcccccccccccEEEEccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHcccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHccccccccccccccHHEccccccccccccEEEEEcccccccccEEccccccEEEEcccccccccEEEEEcHHHHHHHHHccccccccEccHHHccccccccccEEEcccccccccccccccEEEccccccEEEccccHEHHHHHccccccccccccccEEEccc
mdfrpsrmAVVAKQVEAFVREffdqnplsqiglvtvKDGVANcltdlggspesHIKALMGklgcsgdssLQNALDLVQGLLsqipsyghrEVLILYSalstcdpgdiMETIQKCKESKIRCSVIGLSAEMFICKHlcqdtggsysvaldeSHFKELimehappppaIAEFAIANLIkmgfpqragegsisicschkevkvgvgytcprckarvcelptdcricglqlvssphlarsyhhlfpiapfdevtplclndprnrsrstcfgcqqsllssgnkpglyvacpkckkhfclECDIYIheslhncpgceslrhsnpivaneg
mdfrpsrmAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHncpgceslrhsnpivaneg
MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHappppaiaefaiaNLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG
********AVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCE*************
MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIK*************LQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVT************STCFGCQQS**********YVACPKCKKHFCLECDIYIHESLHNCPGCESLR**********
*********VVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG
MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLFPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLRHSNPIVANEG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query324 2.2.26 [Sep-21-2011]
Q86KZ2461 General transcription fac yes no 0.925 0.650 0.469 1e-80
Q2TBV5395 General transcription fac yes no 0.919 0.754 0.450 1e-73
A0JN27396 General transcription fac yes no 0.916 0.75 0.447 5e-73
Q04673461 Suppressor of stem-loop p yes no 0.941 0.661 0.448 8e-72
O74995421 TFIIH basal transcription yes no 0.938 0.722 0.442 1e-71
Q13888395 General transcription fac yes no 0.919 0.754 0.456 4e-70
Q6P1K8395 General transcription fac yes no 0.919 0.754 0.456 5e-70
Q9JIB4396 General transcription fac yes no 0.916 0.75 0.441 3e-69
P34567376 General transcription fac yes no 0.895 0.771 0.419 8e-62
>sp|Q86KZ2|TF2H2_DICDI General transcription factor IIH subunit 2 OS=Dictyostelium discoideum GN=gtf2h2 PE=3 SV=2 Back     alignment and function desciption
 Score =  300 bits (767), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 204/313 (65%), Gaps = 13/313 (4%)

Query: 2   DFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGK 61
           D +PSR  V+ + VE F++EFFDQNP+SQ+ ++  K+  A  +++L G+   HI+A+   
Sbjct: 113 DLKPSRYQVLLQNVELFIKEFFDQNPISQLSIIITKNSKAEKISELSGNRLRHIQAMKDA 172

Query: 62  LGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRC 121
           +   G+ S+QN+L++    L  +P YG REVL ++S+L+TCDP  + +TIQ  K   IR 
Sbjct: 173 IAMEGEPSIQNSLEVALSSLCYVPKYGSREVLFIFSSLTTCDPSSLQKTIQSLKNESIRV 232

Query: 122 SVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGFP 181
           S I ++AE++ICK + + T G+  V L+E HF E +M    PPP I +   A L++MGFP
Sbjct: 233 SFIHMAAELYICKAIAEQTNGTSKVILNEEHFNESLMLKCQPPPTIGKTEAA-LVEMGFP 291

Query: 182 QRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHLF 241
           Q+      S C CH+++K   GY CPRC  + CELPTDC+IC L LVSSPHLARSYHHLF
Sbjct: 292 QQITSTVPSPCICHEKMKYS-GYICPRCGVKSCELPTDCQICNLSLVSSPHLARSYHHLF 350

Query: 242 PIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKP--GLYVACPKCKKHFCLECDIY 299
            I  F+EV    LN        TC GC    LSS  K    L+ +CP+C++ FCL+CD++
Sbjct: 351 QIPLFNEVNWKELN-----KNVTCIGC----LSSSEKSILSLFFSCPRCQEIFCLDCDLF 401

Query: 300 IHESLHNCPGCES 312
           IHESLHNCPGCE+
Sbjct: 402 IHESLHNCPGCEN 414




Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Dictyostelium discoideum (taxid: 44689)
>sp|Q2TBV5|TF2H2_BOVIN General transcription factor IIH subunit 2 OS=Bos taurus GN=GTF2H2 PE=2 SV=1 Back     alignment and function description
>sp|A0JN27|TF2H2_RAT General transcription factor IIH subunit 2 OS=Rattus norvegicus GN=Gtf2h2 PE=2 SV=1 Back     alignment and function description
>sp|Q04673|SSL1_YEAST Suppressor of stem-loop protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL1 PE=1 SV=1 Back     alignment and function description
>sp|O74995|TFH47_SCHPO TFIIH basal transcription factor complex p47 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfh47 PE=1 SV=1 Back     alignment and function description
>sp|Q13888|TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens GN=GTF2H2 PE=1 SV=1 Back     alignment and function description
>sp|Q6P1K8|T2H2L_HUMAN General transcription factor IIH subunit 2-like protein OS=Homo sapiens GN=GTF2H2C PE=2 SV=1 Back     alignment and function description
>sp|Q9JIB4|TF2H2_MOUSE General transcription factor IIH subunit 2 OS=Mus musculus GN=Gtf2h2 PE=1 SV=1 Back     alignment and function description
>sp|P34567|TF2H2_CAEEL General transcription factor IIH subunit 2 OS=Caenorhabditis elegans GN=T16H12.4 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
297746227 494 unnamed protein product [Vitis vinifera] 0.996 0.653 0.842 1e-161
225435253 433 PREDICTED: general transcription factor 0.996 0.745 0.842 1e-161
224119296412 predicted protein [Populus trichocarpa] 0.975 0.766 0.851 1e-158
356571915420 PREDICTED: general transcription factor 0.993 0.766 0.798 1e-156
357509341 426 General transcription factor IIH subunit 0.984 0.748 0.795 1e-154
356538258419 PREDICTED: general transcription factor 0.981 0.758 0.784 1e-153
449451946423 PREDICTED: general transcription factor 0.996 0.763 0.784 1e-152
449525401329 PREDICTED: general transcription factor 0.996 0.981 0.784 1e-151
297848764421 ATGTF2H2/GTF2H2 [Arabidopsis lyrata subs 0.966 0.743 0.802 1e-148
30679101421 transcription initiation factor TFIIH su 0.966 0.743 0.799 1e-147
>gi|297746227|emb|CBI16283.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/323 (84%), Positives = 294/323 (91%)

Query: 1   MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
           MDF+PSRMAVVAK +EAF+REFFDQNPLSQIGLVT+KDG+A CLTDLGGSP+SH+KALMG
Sbjct: 171 MDFKPSRMAVVAKHIEAFIREFFDQNPLSQIGLVTIKDGLAQCLTDLGGSPDSHVKALMG 230

Query: 61  KLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIR 120
           KL CSGDSSLQNALDLV G L+QIPSYGHREVLILYSALSTCDPGDIMETIQ+CK+SKIR
Sbjct: 231 KLECSGDSSLQNALDLVHGYLNQIPSYGHREVLILYSALSTCDPGDIMETIQECKKSKIR 290

Query: 121 CSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKMGF 180
           CSVIGLSAE+FIC+HLCQ+TGGSYSVALDESHFKEL++EHAPPPPAIAEFAIANLIKMGF
Sbjct: 291 CSVIGLSAEIFICRHLCQETGGSYSVALDESHFKELLLEHAPPPPAIAEFAIANLIKMGF 350

Query: 181 PQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL 240
           PQRA EG ISICSCHKE KVG GYTCPRCKARVCELPT+CRICGL LVSSPHLARSYHHL
Sbjct: 351 PQRAAEGVISICSCHKEAKVGGGYTCPRCKARVCELPTECRICGLTLVSSPHLARSYHHL 410

Query: 241 FPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYI 300
           FPI PFDEV+   LN+P  RS   CFGCQ+SLL  GNKP L VACPKCK+HFCL+CDIYI
Sbjct: 411 FPIPPFDEVSLSLLNNPHQRSSRACFGCQESLLIPGNKPTLCVACPKCKQHFCLDCDIYI 470

Query: 301 HESLHNCPGCESLRHSNPIVANE 323
           HESLHNCPGCES RHS  +   E
Sbjct: 471 HESLHNCPGCESFRHSKIVSVTE 493




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435253|ref|XP_002284994.1| PREDICTED: general transcription factor IIH subunit 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224119296|ref|XP_002331276.1| predicted protein [Populus trichocarpa] gi|222873701|gb|EEF10832.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356571915|ref|XP_003554116.1| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357509341|ref|XP_003624959.1| General transcription factor IIH subunit [Medicago truncatula] gi|355499974|gb|AES81177.1| General transcription factor IIH subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538258|ref|XP_003537621.1| PREDICTED: general transcription factor IIH subunit 2-like [Glycine max] Back     alignment and taxonomy information
>gi|449451946|ref|XP_004143721.1| PREDICTED: general transcription factor IIH subunit 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525401|ref|XP_004169706.1| PREDICTED: general transcription factor IIH subunit 2-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|297848764|ref|XP_002892263.1| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata] gi|297338105|gb|EFH68522.1| ATGTF2H2/GTF2H2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30679101|ref|NP_683275.2| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana] gi|22087278|gb|AAM90909.1|AF499443_1 p44/SSL1-like protein [Arabidopsis thaliana] gi|4056421|gb|AAC97995.1| Similar to gb|Z30094 basic transcripion factor 2, 44 kD subunit from Homo sapiens. EST gb|W43325 comes from this gene [Arabidopsis thaliana] gi|110738828|dbj|BAF01337.1| putative transcription factor [Arabidopsis thaliana] gi|332189663|gb|AEE27784.1| transcription initiation factor TFIIH subunit H2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
TAIR|locus:504956103421 GTF2H2 "general transcription 0.984 0.757 0.743 2.7e-132
DICTYBASE|DDB_G0272362461 gtf2h2 "TFIIH subunit" [Dictyo 0.941 0.661 0.454 8.4e-74
UNIPROTKB|E2R345395 GTF2H2 "Uncharacterized protei 0.919 0.754 0.447 1.3e-70
SGD|S000003995461 SSL1 "Subunit of the core form 0.941 0.661 0.448 4.3e-70
UNIPROTKB|I3LKI8395 GTF2H2 "Uncharacterized protei 0.919 0.754 0.440 8.9e-70
UNIPROTKB|F5GZM1338 GTF2H2C "General transcription 0.919 0.881 0.444 2.4e-69
UNIPROTKB|J3KQC7338 GTF2H2 "General transcription 0.919 0.881 0.444 2.4e-69
UNIPROTKB|Q13888395 GTF2H2 "General transcription 0.919 0.754 0.444 2.4e-69
UNIPROTKB|Q6P1K8395 GTF2H2C "General transcription 0.919 0.754 0.444 2.4e-69
POMBASE|SPCC1682.07421 ssl1 "transcription factor TFI 0.938 0.722 0.429 2.4e-69
TAIR|locus:504956103 GTF2H2 "general transcription factor II H2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1297 (461.6 bits), Expect = 2.7e-132, P = 2.7e-132
 Identities = 238/320 (74%), Positives = 269/320 (84%)

Query:     1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
             MDFRPSRMA++AK VEAF+REFFDQNPLSQIGLV++K+GVA+ LTDLGGSPE+HIKALMG
Sbjct:    97 MDFRPSRMAIMAKHVEAFIREFFDQNPLSQIGLVSIKNGVAHTLTDLGGSPETHIKALMG 156

Query:    61 KLGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIR 120
             KL   GDSSLQNAL+LV   L+Q+PSYGHREVLILYSAL TCDPGDIMETIQKCK+SK+R
Sbjct:   157 KLEALGDSSLQNALELVHEHLNQVPSYGHREVLILYSALCTCDPGDIMETIQKCKKSKLR 216

Query:   121 CSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHXXXXXXXXXXXXXNLIKMGF 180
             CSVIGLSAEMFICKHLCQ+TGG YSVA+DE H K+L++EH             NLIKMGF
Sbjct:   217 CSVIGLSAEMFICKHLCQETGGLYSVAVDEVHLKDLLLEHAPPPPAIAEFAIANLIKMGF 276

Query:   181 PQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL 240
             PQRA EGS++ICSCHKEVK+G GY CPRCKARVC+LPT+C ICGL LVSSPHLARSYHHL
Sbjct:   277 PQRAAEGSMAICSCHKEVKIGAGYMCPRCKARVCDLPTECTICGLTLVSSPHLARSYHHL 336

Query:   241 FPIAPFDEVTPLC-LNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIY 299
             FPIAPFDEV  L  LND R +   +CFGCQQSL+ +GNKP   V C KCK +FCL+CDIY
Sbjct:   337 FPIAPFDEVPALSSLNDNRRKLGKSCFGCQQSLIGAGNKPVPCVTCRKCKHYFCLDCDIY 396

Query:   300 IHESLHNCPGCESLRHSNPI 319
             IHESLHNCPGCES+     +
Sbjct:   397 IHESLHNCPGCESIHRPKSV 416




GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006281 "DNA repair" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005675 "holo TFIIH complex" evidence=IGI
GO:0006289 "nucleotide-excision repair" evidence=IGI
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IGI
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
DICTYBASE|DDB_G0272362 gtf2h2 "TFIIH subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E2R345 GTF2H2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
SGD|S000003995 SSL1 "Subunit of the core form of RNA polymerase transcription factor TFIIH" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKI8 GTF2H2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5GZM1 GTF2H2C "General transcription factor IIH subunit 2-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQC7 GTF2H2 "General transcription factor IIH subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13888 GTF2H2 "General transcription factor IIH subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P1K8 GTF2H2C "General transcription factor IIH subunit 2-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPCC1682.07 ssl1 "transcription factor TFIIH complex subunit Ssl1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
pfam04056193 pfam04056, Ssl1, Ssl1-like 1e-102
COG5151421 COG5151, SSL1, RNA polymerase II transcription ini 1e-102
cd01453183 cd01453, vWA_transcription_factor_IIH_type, Transc 6e-90
TIGR00622112 TIGR00622, ssl1, transcription factor ssl1 3e-34
pfam0797548 pfam07975, C1_4, TFIIH C1-like domain 2e-18
smart0104749 smart01047, C1_4, TFIIH C1-like domain 3e-15
smart00327175 smart00327, VWA, von Willebrand factor (vWF) type 8e-15
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) 1e-09
pfam13519172 pfam13519, VWA_2, von Willebrand factor type A dom 3e-08
COG5242296 COG5242, TFB4, RNA polymerase II transcription ini 0.003
>gnl|CDD|190848 pfam04056, Ssl1, Ssl1-like Back     alignment and domain information
 Score =  298 bits (766), Expect = e-102
 Identities = 114/183 (62%), Positives = 134/183 (73%), Gaps = 2/183 (1%)

Query: 1   MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMG 60
            D RPSR A   K +E FV EFFDQNP+SQIGL+T KDG A+ LTDL G+P  HIKAL  
Sbjct: 11  KDLRPSRFACTIKYLETFVEEFFDQNPISQIGLITCKDGRAHRLTDLTGNPRVHIKALKS 70

Query: 61  KLG--CSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESK 118
                C GD SLQNAL+L +  L  +PS+G REVLI++ +LSTCDPGDI  TI   K+ K
Sbjct: 71  LREAECGGDPSLQNALELARASLKHVPSHGSREVLIIFGSLSTCDPGDIYSTIDTLKKEK 130

Query: 119 IRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKM 178
           IRCSVIGLSAE+FICK LC+ T G+YSVALDE+H KEL++EH  PPPA      A+LIKM
Sbjct: 131 IRCSVIGLSAEVFICKELCKATNGTYSVALDETHLKELLLEHVLPPPAAKSSTEASLIKM 190

Query: 179 GFP 181
           GFP
Sbjct: 191 GFP 193


Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex. Length = 193

>gnl|CDD|227480 COG5151, SSL1, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238730 cd01453, vWA_transcription_factor_IIH_type, Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>gnl|CDD|129709 TIGR00622, ssl1, transcription factor ssl1 Back     alignment and domain information
>gnl|CDD|116585 pfam07975, C1_4, TFIIH C1-like domain Back     alignment and domain information
>gnl|CDD|214993 smart01047, C1_4, TFIIH C1-like domain Back     alignment and domain information
>gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|222192 pfam13519, VWA_2, von Willebrand factor type A domain Back     alignment and domain information
>gnl|CDD|227567 COG5242, TFB4, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 324
KOG2807378 consensus RNA polymerase II transcription initiati 100.0
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 100.0
PF04056193 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro 100.0
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 100.0
TIGR00627279 tfb4 transcription factor tfb4. This family is bas 100.0
PF03850276 Tfb4: Transcription factor Tfb4; InterPro: IPR0046 100.0
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 100.0
KOG2487314 consensus RNA polymerase II transcription initiati 100.0
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 99.97
COG5242296 TFB4 RNA polymerase II transcription initiation/nu 99.95
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 99.86
KOG2884259 consensus 26S proteasome regulatory complex, subun 99.84
PRK13685326 hypothetical protein; Provisional 99.77
COG5148243 RPN10 26S proteasome regulatory complex, subunit R 99.75
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 99.7
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 99.62
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 99.61
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. 99.56
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 99.51
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 99.48
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 99.47
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 99.44
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 99.44
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 99.42
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 99.42
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 99.41
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 99.41
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 99.4
cd01470198 vWA_complement_factors Complement factors B and C2 99.4
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 99.37
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 99.36
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 99.32
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 99.31
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 99.27
PRK13406584 bchD magnesium chelatase subunit D; Provisional 99.24
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 99.23
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 99.22
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 99.12
PF00092178 VWA: von Willebrand factor type A domain; InterPro 99.12
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 99.07
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.0
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 98.99
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.97
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 98.95
PF13768155 VWA_3: von Willebrand factor type A domain 98.93
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 98.93
TIGR03788596 marine_srt_targ marine proteobacterial sortase tar 98.92
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 98.83
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 98.76
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 98.74
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 98.73
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 98.69
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 98.64
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 98.23
cd01479244 Sec24-like Sec24-like: Protein and membrane traffi 97.99
PF04811243 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I 97.95
cd01468239 trunk_domain trunk domain. COPII-coated vesicles c 97.86
cd01478267 Sec23-like Sec23-like: Protein and membrane traffi 97.63
PLN00162 761 transport protein sec23; Provisional 97.44
PF03731224 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte 97.4
COG4245207 TerY Uncharacterized protein encoded in toxicity p 96.98
PF10138200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 96.9
TIGR00578 584 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit 96.38
KOG1984 1007 consensus Vesicle coat complex COPII, subunit SFB3 96.18
PTZ00395 1560 Sec24-related protein; Provisional 96.08
PRK10997487 yieM hypothetical protein; Provisional 96.07
PF11265226 Med25_VWA: Mediator complex subunit 25 von Willebr 95.89
KOG1986 745 consensus Vesicle coat complex COPII, subunit SEC2 95.87
PF05762222 VWA_CoxE: VWA domain containing CoxE-like protein; 94.77
COG2304399 Uncharacterized protein containing a von Willebran 93.88
PF07002146 Copine: Copine; InterPro: IPR010734 This represent 93.74
COG2425437 Uncharacterized protein containing a von Willebran 93.71
COG4867652 Uncharacterized protein with a von Willebrand fact 93.7
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 93.26
COG5028 861 Vesicle coat complex COPII, subunit SEC24/subunit 92.82
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 92.76
smart00187423 INB Integrin beta subunits (N-terminal portion of 92.09
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 91.76
PF06707205 DUF1194: Protein of unknown function (DUF1194); In 91.51
cd01459254 vWA_copine_like VWA Copine: Copines are phospholip 91.17
TIGR00288160 conserved hypothetical protein TIGR00288. This fam 91.11
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 89.8
KOG1985 887 consensus Vesicle coat complex COPII, subunit SEC2 89.51
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 88.61
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 88.09
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 87.8
PRK06266178 transcription initiation factor E subunit alpha; V 87.05
PRK04023 1121 DNA polymerase II large subunit; Validated 86.31
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.4
PRK12496164 hypothetical protein; Provisional 83.83
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 82.28
cd06167149 LabA_like LabA_like proteins. A well conserved gro 81.94
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 81.9
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 81.4
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.29
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 80.79
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 80.58
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
Probab=100.00  E-value=2.2e-107  Score=760.01  Aligned_cols=302  Identities=60%  Similarity=1.083  Sum_probs=287.5

Q ss_pred             CCCCCcHHHHHHHHHHHHHHHHhcCCcCCceEEEEeeCCeeeEeecCCCCHHHHHHHHhhhcCCCCcchHHHHHHHHHHH
Q 020594            1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGL   80 (324)
Q Consensus         1 ~D~~P~Rl~~~~~~l~~Fv~~~f~qNP~sqlGiI~~~~g~a~~l~~lt~n~~~~~~~L~~~~~~~G~~sL~naL~~A~~~   80 (324)
                      +||+|||+..+.++++.||.+||||||+||||||+++||+|++++.+|||++.|+++|+.+.++.|++||||||+||...
T Consensus        76 ~Df~P~r~a~~~K~le~Fv~eFFdQNPiSQigii~~k~g~A~~lt~ltgnp~~hI~aL~~~~~~~g~fSLqNaLe~a~~~  155 (378)
T KOG2807|consen   76 KDFRPSRFANVIKYLEGFVPEFFDQNPISQIGIISIKDGKADRLTDLTGNPRIHIHALKGLTECSGDFSLQNALELAREV  155 (378)
T ss_pred             ccCCchHHHHHHHHHHHHHHHHhccCchhheeEEEEecchhhHHHHhcCCHHHHHHHHhcccccCCChHHHHHHHHHHHH
Confidence            59999999999999999999999999999999999999999999999999999999999887899999999999999999


Q ss_pred             hhCCCCCCCceEEEEEeCCCCCCcccHHHHHHHHHhcCcEEEEEEccchHHHHHHHHHhhCCeeEEeCCHHHHHHHHHhc
Q 020594           81 LSQIPSYGHREVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEH  160 (324)
Q Consensus        81 L~~~p~~~~reILil~gS~~t~d~g~i~~ti~~akk~~IrV~vI~Lgae~~iLk~ia~~TgG~Y~va~d~~hl~~lL~~~  160 (324)
                      |+++|+|.+||||||+||+.|+|||||++||+++|+.+|||++|||+||+.|+|++|+.|||.|.|++|++||++||.++
T Consensus       156 Lk~~p~H~sREVLii~sslsT~DPgdi~~tI~~lk~~kIRvsvIgLsaEv~icK~l~kaT~G~Y~V~lDe~HlkeLl~e~  235 (378)
T KOG2807|consen  156 LKHMPGHVSREVLIIFSSLSTCDPGDIYETIDKLKAYKIRVSVIGLSAEVFICKELCKATGGRYSVALDEGHLKELLLEH  235 (378)
T ss_pred             hcCCCcccceEEEEEEeeecccCcccHHHHHHHHHhhCeEEEEEeechhHHHHHHHHHhhCCeEEEEeCHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccchhhhhhceeeecCCCCCCCCCccceeecCCccccCeeEcCCCCcccccCCCCCCCCCceecCchhHHhhhccc
Q 020594          161 APPPPAIAEFAIANLIKMGFPQRAGEGSISICSCHKEVKVGVGYTCPRCKARVCELPTDCRICGLQLVSSPHLARSYHHL  240 (324)
Q Consensus       161 ~~pp~~~~~~~~~~Li~mGfP~~~~~~~~a~C~CH~~~~~~~Gy~Cp~C~s~~C~lP~~C~~C~l~Lvs~~hLarsyhhl  240 (324)
                      +.|||+.+. .+.+|||||||++...+.+++|+||..++.. ||.||||++++|+||++||+|+|+||||||||||||||
T Consensus       236 ~~Pp~~~~~-~~~sLvkmGFP~~~~e~~ps~C~CH~~~~~~-Gy~CP~CkakvCsLP~eCpiC~ltLVss~hLARSyhhL  313 (378)
T KOG2807|consen  236 THPPPANKS-KECSLVKMGFPSRSPEDTPSFCACHSELSGG-GYFCPQCKAKVCSLPIECPICSLTLVSSPHLARSYHHL  313 (378)
T ss_pred             CCCCCcccc-cCCceEEecCCCcccccCcchheeccccccC-ceeCCcccCeeecCCccCCccceeEecchHHHHHHHhh
Confidence            999998744 3899999999999999999999999888888 99999999999999999999999999999999999999


Q ss_pred             CCCCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhhcCCCCCCCCCCC
Q 020594          241 FPIAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCESLR  314 (324)
Q Consensus       241 ~p~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCd~fihe~lh~CpgC~~~~  314 (324)
                      |||++|+|++     |.+..+++.||+|+..+.     ++.+|+|+.|+++||.|||+||||+||+||||+.++
T Consensus       314 ~PL~~F~Eip-----~~~~~~~~~Cf~C~~~~~-----~~~~y~C~~Ck~~FCldCDv~iHesLh~CpgCeh~~  377 (378)
T KOG2807|consen  314 FPLKPFVEIP-----ETEYNGSRFCFACQGELL-----SSGRYRCESCKNVFCLDCDVFIHESLHNCPGCEHKP  377 (378)
T ss_pred             cCCcchhhcc-----ccccCCCcceeeeccccC-----CCCcEEchhccceeeccchHHHHhhhhcCCCcCCCC
Confidence            9999999996     445567889999964443     346899999999999999999999999999999654



>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00627 tfb4 transcription factor tfb4 Back     alignment and domain information
>PF03850 Tfb4: Transcription factor Tfb4; InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>KOG2487 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] Back     alignment and domain information
>cd01468 trunk_domain trunk domain Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PLN00162 transport protein sec23; Provisional Back     alignment and domain information
>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) Back     alignment and domain information
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00395 Sec24-related protein; Provisional Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells Back     alignment and domain information
>KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length Back     alignment and domain information
>cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium Back     alignment and domain information
>TIGR00288 conserved hypothetical protein TIGR00288 Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd06167 LabA_like LabA_like proteins Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
1z60_A59 Solution Structure Of The Carboxy-Terminal Domain O 4e-05
>pdb|1Z60|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Human Tfiih P44 Subunit Length = 59 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 5/46 (10%) Query: 265 CFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGC 310 C+GCQ L +YV C C+ FC++CD+++H+SLH+CPGC Sbjct: 18 CYGCQGEL----KDQHVYV-CAVCQNVFCVDCDVFVHDSLHSCPGC 58

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 1e-37
1z60_A59 TFIIH basal transcription factor complex P44 subun 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 Back     alignment and structure
 Score =  132 bits (332), Expect = 1e-37
 Identities = 30/181 (16%), Positives = 65/181 (35%), Gaps = 13/181 (7%)

Query: 2   DFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGK 61
           D+ P+R       V     +  + NP +  GL+T+ D     L+ L       + A+   
Sbjct: 19  DYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAM-HD 77

Query: 62  LGCSGDSSLQNALDLVQGLLSQIPSYGHREVLILYSA-LSTCDPGDIMETIQKCKESKIR 120
           L   G++   + + + Q  L    +   R+ ++ +       D  +++   ++ K++ + 
Sbjct: 78  LPVRGNAKFGDGIQIAQLALKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVA 137

Query: 121 CSVI--GLSAEMFICKHLCQDTGGSYSVALDESHFKELIMEHAPPPPAIAEFAIANLIKM 178
             +I  G        +H       S     D  H   +     P P  +++    + I  
Sbjct: 138 IDIIHIGELQNESALQHFIDAANSS-----DSCHLVSI----PPSPQLLSDLVNQSPIGQ 188

Query: 179 G 179
           G
Sbjct: 189 G 189


>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Length = 59 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 99.92
4b4t_W268 RPN10, 26S proteasome regulatory subunit RPN10; hy 99.91
1z60_A59 TFIIH basal transcription factor complex P44 subun 99.86
3ibs_A218 Conserved hypothetical protein BATB; structural ge 99.72
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, 99.6
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold 99.55
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, 99.54
2b2x_A223 Integrin alpha-1; computational design, antibody-a 99.53
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, anta 99.51
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell a 99.5
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.5
1atz_A189 VON willebrand factor; collagen-binding, hemostasi 99.49
4hqo_A266 Sporozoite surface protein 2; malaria, gliding mot 99.48
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 99.47
4hqf_A281 Thrombospondin-related anonymous protein, trap; ma 99.46
1pt6_A213 Integrin alpha-1; cell adhesion; 1.87A {Homo sapie 99.45
4fx5_A464 VON willebrand factor type A; structural genomics, 99.44
1jey_B 565 KU80; double-strand DNA break repair, non-homologo 99.41
3n2n_F185 Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho 99.4
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.34
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 99.33
2odp_A 509 Complement C2; C3/C5 convertase, complement serin 99.32
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hy 99.26
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1. 99.12
3zqk_A199 VON willebrand factor; blood clotting, adamts-13, 99.11
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule 99.03
1jey_A 609 KU70; double-strand DNA break repair, non-homologo 98.99
3rag_A242 Uncharacterized protein; structural genomics, PSI- 98.41
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 98.18
2nvo_A535 RO sixty-related protein, RSR; alpha helical repea 98.0
2nut_A 769 Protein transport protein SEC23A; human copii SEC2 97.94
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 97.66
2ww8_A 893 RRGA, cell WALL surface anchor family protein; IGG 97.51
1m2o_A 768 SEC23, protein transport protein SEC23, SEC23P; zi 97.43
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 97.41
3eh1_A 751 Protein transport protein SEC24B; copii coat prote 97.17
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limb 96.92
3rag_A242 Uncharacterized protein; structural genomics, PSI- 96.72
3eh2_A 766 Protein transport protein SEC24C; copii-coat prote 96.51
3efo_B 770 SEC24 related gene family, member D; copii, coat p 96.48
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 95.45
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 93.93
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 92.47
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 92.03
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 91.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 91.39
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 91.3
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 91.18
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 91.13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 90.82
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 90.46
2ect_A78 Ring finger protein 126; metal binding protein, st 90.26
2ecw_A85 Tripartite motif-containing protein 30; metal bind 90.01
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 89.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 89.62
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 89.57
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 89.31
3vi3_B454 Integrin beta-1; beta propeller fold, rossman fold 89.21
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 89.13
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 88.44
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 88.05
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 87.87
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 87.82
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 87.82
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 87.63
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 86.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 86.83
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 86.51
2ecm_A55 Ring finger and CHY zinc finger domain- containing 86.3
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 86.26
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 85.97
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 85.55
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 85.51
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 84.88
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 84.76
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 84.67
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 84.62
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 84.48
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 84.02
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 82.93
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 82.82
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 82.81
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 82.6
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 82.29
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 82.03
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 81.91
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 81.81
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 81.79
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 81.5
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 81.31
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 81.17
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 80.6
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 80.45
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 80.23
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=99.92  E-value=1.5e-24  Score=193.31  Aligned_cols=139  Identities=15%  Similarity=0.271  Sum_probs=125.3

Q ss_pred             CCCCCcHHHHHHHHHHHHHHHHhcCCcCCceEEEEeeCCeeeEeecCCCCHHHHHHHHhhhcCCCCcchHHHHHHHHHHH
Q 020594            1 MDFRPSRMAVVAKQVEAFVREFFDQNPLSQIGLVTVKDGVANCLTDLGGSPESHIKALMGKLGCSGDSSLQNALDLVQGL   80 (324)
Q Consensus         1 ~D~~P~Rl~~~~~~l~~Fv~~~f~qNP~sqlGiI~~~~g~a~~l~~lt~n~~~~~~~L~~~~~~~G~~sL~naL~~A~~~   80 (324)
                      +||.||||+++++++..|+++|+++||.+++|||+|+++.+++++|+|.|++.+.+.|+++ .+.|+++|++||++|...
T Consensus        18 ~D~~psRl~~ak~~~~~~~~~~~~~~~~d~vGLV~fa~~~a~~~~plT~d~~~i~~~L~~l-~~~g~t~l~~aL~~A~~~   96 (192)
T 2x5n_A           18 GDYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAMHDL-PVRGNAKFGDGIQIAQLA   96 (192)
T ss_dssp             TTSSSCHHHHHHHHHHHHHHHHHHHCTTCEEEEEECCTTSCCEEEEEESCHHHHHHHHTTC-CCCSCCCHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHhcCCCCeEEEEEEcCCCcEEecCCCCCHHHHHHHHHcC-CCCCCchHHHHHHHHHHH
Confidence            5999999999999999999999999999999999998657999999999999999999985 677889999999999999


Q ss_pred             hhCCCCCCCc-eEEEEEeCCCCCCcccHHHHHHHHHhcCcEEEEEEccchH---HHHHHHHHhhC
Q 020594           81 LSQIPSYGHR-EVLILYSALSTCDPGDIMETIQKCKESKIRCSVIGLSAEM---FICKHLCQDTG  141 (324)
Q Consensus        81 L~~~p~~~~r-eILil~gS~~t~d~g~i~~ti~~akk~~IrV~vI~Lgae~---~iLk~ia~~Tg  141 (324)
                      |++.+.+..+ |||||++++.+.|++++.++++.+|++||+|++|++|.+.   . |+++++.++
T Consensus        97 l~~~~~~~~~~riiil~~~~~~~~~~~~~~~a~~lk~~gi~v~~Ig~G~~~~~~~-l~~la~~~n  160 (192)
T 2x5n_A           97 LKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVAIDIIHIGELQNESA-LQHFIDAAN  160 (192)
T ss_dssp             HHTCSCTTSEEEEEEEECSCCSSCHHHHHHHHHHHHHTTEEEEEEEESCC---CH-HHHHHHHHC
T ss_pred             HHhccccCCCceEEEEEECCCCCCchhHHHHHHHHHHCCCEEEEEEeCCCCccHH-HHHHHHhcc
Confidence            9998765544 5777776666778899999999999999999999999875   6 999999976



>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A* Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G Back     alignment and structure
>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A Back     alignment and structure
>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure
>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A* Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3vi3_B Integrin beta-1; beta propeller fold, rossman fold, beta sandwich, fibronecti receptor, cell adhesion-immune system complex; HET: NAG BMA MAN; 2.90A {Homo sapiens} PDB: 3vi4_B* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 324
d1z60a159 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-ri 1e-16
d1jeyb2236 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain 7e-04
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: TFIIH p44 subunit cysteine-rich domain
domain: TFIIH p44 subunit cysteine-rich domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.6 bits (173), Expect = 1e-16
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 243 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHE 302
           +  F E+     N  R      C+GCQ  L            C  C+  FC++CD+++H+
Sbjct: 1   LDAFQEIPLEEYNGERF-----CYGCQGELKDQH-----VYVCAVCQNVFCVDCDVFVHD 50

Query: 303 SLHNCPGC 310
           SLH+CPGC
Sbjct: 51  SLHSCPGC 58


>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 99.87
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 99.28
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 99.28
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapien 99.26
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 99.2
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 99.15
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [ 99.15
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 99.14
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 99.14
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 99.07
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 99.04
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated 98.47
d1pd0a3252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 98.22
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxI 98.14
d2qtva3271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 98.07
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 97.28
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 94.02
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 92.94
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 91.85
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.56
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 90.55
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 90.42
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 90.09
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 89.39
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 88.93
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 87.97
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.27
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 86.36
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.73
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 82.26
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 82.21
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: TFIIH p44 subunit cysteine-rich domain
domain: TFIIH p44 subunit cysteine-rich domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=2.1e-24  Score=153.66  Aligned_cols=59  Identities=36%  Similarity=0.975  Sum_probs=51.2

Q ss_pred             CCCCcccCccCCCCCCCCCCCccccccccccCCCCCCCceeeCCCCCcccccccchhhhhcCCCCCCCC
Q 020594          243 IAPFDEVTPLCLNDPRNRSRSTCFGCQQSLLSSGNKPGLYVACPKCKKHFCLECDIYIHESLHNCPGCE  311 (324)
Q Consensus       243 ~~~f~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~C~~C~~~fC~dCd~fihe~lh~CpgC~  311 (324)
                      |++|+||+++     +..+++.||||+++|++     +++|+|++|+++||+|||+||||+|||||||.
T Consensus         1 L~~F~EVp~~-----~~~~~~~C~gC~~~l~~-----~~~y~C~~C~~~FC~dCD~fiHe~lh~CpgCl   59 (59)
T d1z60a1           1 LDAFQEIPLE-----EYNGERFCYGCQGELKD-----QHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI   59 (59)
T ss_dssp             CCSCCEEEHH-----HHCSCCEETTTTEECTT-----SEEECCTTTTCCBCHHHHHTTTTTSCSSSTTC
T ss_pred             CCCcceeehh-----hcCCCCCccCCCCcCCC-----CceEECcCCCCccccccchhhhhhhcCCCCCC
Confidence            6899999753     33467899999998863     36899999999999999999999999999995



>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure