Citrus Sinensis ID: 020595


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MLEGFNEMDALAERGFVPGMTKEERENLARSETLAIRISNVANMVLFAAKVYASVKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSVTLVKLLLVVYCRAFTNEIVKAYAQDHFFDVITNIIGLVAVLLANYIDDWMDPVGAIILALYTIRTWSMTVLENVNSLVGRSAAPEYLQKLTYLCWNHHKSIRHIDTVRAYTFGSHYFVEVDIVLPASMPLQEAHDIGESLQEKLELLPEIERAFVHLDYEYTHRPEHAQAHY
ccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccc
M**GFNEM************************TLAIRISNVANMVLFAAKVYASVKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSVTLVKLLLVVYCRAFTNEIVKAYAQDHFFDVITNIIGLVAVLLANYIDDWMDPVGAIILALYTIRTWSMTVLENVNSLVGRSAAPEYLQKLTYLCWNHHKSIRHIDTVRAYTFGSHYFVEVDIVLPASMPLQEAHDIGESLQEKLELLPEIERAFVHLDYEYT**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEGFNEMDALAERGFVPGMTKEERENLARSETLAIRISNVANMVLFAAKVYASVKSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFASVMATLGLQIILESLRTLVSNEDQFNLTKEQEQWVVGIMLSVTLVKLLLVVYCRAFTNEIVKAYAQDHFFDVITNIIGLVAVLLANYIDDWMDPVGAIILALYTIRTWSMTVLENVNSLVGRSAAPEYLQKLTYLCWNHHKSIRHIDTVRAYTFGSHYFVEVDIVLPASMPLQEAHDIGESLQEKLELLPEIERAFVHLDYEYTHRPEHAQAHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal tolerance protein 11 Cation/proton antiporter involved in endogenous manganese tolerance probably through vesicular trafficking and exocytosis.confidentO80632
Metal tolerance protein 5 Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.probableQ5NA18

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H90, chain A
Confidence level:very confident
Coverage over the Query: 49-314
View the alignment between query and template
View the model in PyMOL