Citrus Sinensis ID: 020607

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MAASTVSMAASSSLCNKLYNLQAITQIPTNHLPSLFKTKSPKPLKLEKAQNPSALHLSLLSLSYFRQFSASFDGFQVTEDSQDEPETEQEEEEEEEAVEEEEEPKVAASDEAARLYVGNLPYSMTSSSLAEVFAEAGTVASAEIVYDRVTDRSRGFGFVTMGSVEEAKEAIRLFDGSQIGGRTVKVNFPEVPRGGERAAMGPKLQNSYQGFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLNMANERAPPVLPAAKETKTENSIDGSELLSSIST

cccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccCCccCEEEEEcccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccccEEEEEEEccccccccEEEEEEccHHHHHHHHHHcccCECccCEEEEEccccccccccccHHccccccccccccccccccc

*************LCNKLYNLQAITQIPTNHL***************KAQNPSALHLSLLSLSYFRQFSASFDGF**************************************RLYVGNLPYSMTSSSLAEVFAEAGTVASAEIVYDRVTDRSRGFGFVTMGSVEEAKEAIRLFDGSQIGGRTVKVNFP*****************SYQGFVDSPHKIYAGNLGWGLTSQGLRDAFQGQPGLLSAKVIFERYTGRSRGFGFVTFETAEDLQSALDAMNGVEVEGRPLRLN*********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
33 kDa ribonucleoprotein, chloroplastic	Could be involved in splicing and/or processing of chloroplast RNA's.	probable	P19684

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FXL, chain A
Confidence level:very confident
Coverage over the Query: 111-194,212-292
View the alignment between query and template
View the model in PyMOL

Template: 2QFJ, chain A
Confidence level:very confident
Coverage over the Query: 112-302
View the alignment between query and template
View the model in PyMOL

Template: 3PGW, chain S
Confidence level:very confident
Coverage over the Query: 57-192
View the alignment between query and template
View the model in PyMOL