Citrus Sinensis ID: 020666

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MAMNARSSPTKSSDELVLRSELWNGRDEPRVAFASVNAEEDKPFNFLHVLFDCAIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKINLKGLYSGLVGNLAGAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQTGQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRSLSNAENAIVGAFAGAITGAVTAPLDVIKTRLMVQGSANQYKGICDCVSTIAREEGISTLFKGMGPRVLWIGIGGSIFFGVLEKTKEVLAQRHFNSQDSSSFKLD

cccccccccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHEEEccHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccHHHHHHHHHHHHcHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc

*********************LWN*****RVAFASVNAEEDKPFNFLHVLFDCAIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKINLKGLYSGLVGNLAGAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQTGQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRSLSNAENAIVGAFAGAITGAVTAPLDVIKTRLMVQGSANQYKGICDCVSTIAREEGISTLFKGMGPRVLWIGIGGSIFFGVLEKTKEVLA***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
S-adenosylmethionine mitochondrial carrier protein homolog	Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May mediate the transport of S-adenosylmethionine (SAM) into the mitochondria.	probable	Q9VBN7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 53-311
View the alignment between query and template
View the model in PyMOL