Citrus Sinensis ID: 020677

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MKILRRNLVENGPGSVKMEPVDSDDLWFAYNLIAPGDSVMAVTVRKVLRQMASGSRDAERVKLKLEIKVVDYDKEGSVLRIRGKNILENEHVKIGAFHTLEIELHRAFVLRKDLWDSLALDTLHQAADPTASADLAVVLMQEGLAHILLVGRSMTITRSRIETSIPRKHGPAIAGYESALNKFFENVLQAFLKHVDFNVVRCAVIASPGFTKDQFHRHLLLEAERRQLRPIIENKSRIILVHTSSGYKHSLREVLDAPNVMNMIKDTKAAQEVQALKDFFNMLTNDPTRACYGPKHVEVAHERMAVQTLLITDDLFRLVCSKS

ccEEEEEccccccEEEEEEcccccHHHHHHHccccccEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEcccccccccEEEEEEccccEEEEEEEcccHHHHHHHHHHccccccccEEEEEEEccEEEEEEEcccEEEEEEEEEEECccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHcccHHHHHccccEEEEEcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEECcHHHHHHHHHcccccEEEEEccccccccccc

MKIL*******GPGSVKMEPVDSDDLWFAYNLIAPGDSVMAVTVRKVLRQ*********RVKLKLEIKVVDYDKEGSVLRIRGKNILENEHVKIGAFHTLEIELHRAFVLRKDLWDSLALDTLHQAADPTASADLAVVLMQEGLAHILLVGRSMTITRSRIETSIPRKHGPAIAGYESALNKFFENVLQAFLKHVDFNVVRCAVIASPGFTKDQFHRHLLLEAERRQLRPIIENKSRIILVHTSSGYKHSLREVLDAPNVMNMIKDTKAAQEVQALKDFFNMLTNDPTRACYGPKHVEVAHERMAVQTLLITDDLFRLVC***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein pelota	Required prior to the first meiotic division for spindle formation and nuclear envelope breakdown during spermatogenesis. It is also required for normal eye patterning and for mitotic divisions in the ovary. Required for ovarian germ line stem cell self-renewal. May play a role in regulating translation. May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.	probable	P48612
Protein pelota homolog	Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.	probable	Q7ZWC4
Protein pelota homolog	Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.	probable	Q5XIP1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MCA, chain B
Confidence level:very confident
Coverage over the Query: 8-46,67-321
View the alignment between query and template
View the model in PyMOL