Citrus Sinensis ID: 020679

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MKKEVSIPEAPLGSTGKTIPLVGFGTAQFPFGAATEVVKESVVHAIEVGYRHFDTAAIYQSEQPLGEAIAEALRLGLIKSRNELFITSKLWLGHAHRQLVLPALQTSLKNLGLEYIDLYLIHFPGSLKPGTGFPFNKEDIVPLDYEAVWEAMEECQNLGLTKSIGVSNFACKKLERLLATAKIPPAVNQVELNPVWQQKKLRVFCEKKGIHITAYSPLGAKGTRWGTNRVMECQVLKEIANARGKSVAQVSLRWVYQQGVSLVVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRGSRAEVHVSEDGPYKSLEDLWDGEI

cccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHccccccccEECccccccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccc

******I**APLGSTGKTIPLVGFGTAQFPFGAATEVVKESVVHAIEVGYRHFDTAAIYQSEQPLGEAIAEALRLGLIKSRNELFITSKLWLGHAHRQLVLPALQTSLKNLGLEYIDLYLIHFPGSLKPGTGFPFNKEDIVPLDYEAVWEAMEECQNLGLTKSIGVSNFACKKLERLLATAKIPPAVNQVELNPVWQQKKLRVFCEKKGIHITAYSPLGAKGTRWGTNRVMECQVLKEIANARGKSVAQVSLRWVYQQGVSLVVKSFNKERMKENLDIFDWELSAEELQKIEQIPQYRGSRAEVHVSEDGPYKSLEDLWDGEI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NADPH-dependent codeinone reductase 1-3	Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.	probable	Q9SQ68
NADPH-dependent codeinone reductase 1-2	Reduces codeinone to codeine in the penultimate step in morphine biosynthesis. Can use morphinone, hydrocodone and hydromorphone as substrate during reductive reaction with NADPH as cofactor, and morphine and dihydrocodeine as substrate during oxidative reaction with NADP as cofactor.	probable	Q9SQ69
Estradiol 17 beta-dehydrogenase 5	Active toward androgens, estrogens, and xenobiotic substrates. Also exhibits low 20 alpha-HSD activity. Shows a-stereospecificity in hydrogen transfer between cofactors and substrates (A-specific). Preferentially catalyzes the reduction of 4-androstenedione, 5-alpha-androstane-3,17-dione, androsterone and dehydroepiandrosterone to testosterone, dihydrotestosterone, 5-alpha-androstane-3-alpha,17-beta-diol and 5-androstene-3-beta,17-beta-diol, respectively.	probable	P70694

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H7U, chain A
Confidence level:very confident
Coverage over the Query: 6-323
View the alignment between query and template
View the model in PyMOL