BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020708
         (322 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1U5T|C Chain C, Structure Of The Escrt-Ii Endosomal Trafficking Complex
 pdb|1U5T|D Chain D, Structure Of The Escrt-Ii Endosomal Trafficking Complex
 pdb|1W7P|B Chain B, The Crystal Structure Of Endosomal Complex Escrt-Ii
           (Vps22VPS25VPS36)
 pdb|1W7P|C Chain C, The Crystal Structure Of Endosomal Complex Escrt-Ii
           (Vps22VPS25VPS36)
 pdb|1XB4|A Chain A, Crystal Structure Of Subunit Vps25 Of The Endosomal
           Trafficking Complex Escrt-Ii
 pdb|1XB4|B Chain B, Crystal Structure Of Subunit Vps25 Of The Endosomal
           Trafficking Complex Escrt-Ii
 pdb|1XB4|C Chain C, Crystal Structure Of Subunit Vps25 Of The Endosomal
           Trafficking Complex Escrt-Ii
 pdb|1XB4|D Chain D, Crystal Structure Of Subunit Vps25 Of The Endosomal
           Trafficking Complex Escrt-Ii
          Length = 202

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 10/53 (18%)

Query: 81  ITEEERILPVTEE--------TPLKFLLWVVF--WASLSLVWFSTSGDANAAV 123
           +T+E + LP+ +         T   F+LW     WASL L WF  SG  N  +
Sbjct: 97  MTKEGKCLPIDQSGRRSSNTTTTRYFILWKSLDSWASLILQWFEDSGKLNQVI 149


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.135    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,345,153
Number of Sequences: 62578
Number of extensions: 306851
Number of successful extensions: 757
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 757
Number of HSP's gapped (non-prelim): 2
length of query: 322
length of database: 14,973,337
effective HSP length: 99
effective length of query: 223
effective length of database: 8,778,115
effective search space: 1957519645
effective search space used: 1957519645
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)