Citrus Sinensis ID: 020736
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 322 | ||||||
| 224063261 | 321 | predicted protein [Populus trichocarpa] | 0.990 | 0.993 | 0.746 | 1e-131 | |
| 356508073 | 321 | PREDICTED: F-box protein FBW2-like isofo | 0.993 | 0.996 | 0.718 | 1e-122 | |
| 255545780 | 329 | ubiquitin-protein ligase, putative [Rici | 0.996 | 0.975 | 0.693 | 1e-120 | |
| 449436998 | 318 | PREDICTED: F-box protein FBW2-like [Cucu | 0.987 | 1.0 | 0.673 | 1e-119 | |
| 225467167 | 317 | PREDICTED: F-box protein FBW2 isoform 1 | 0.984 | 1.0 | 0.670 | 1e-117 | |
| 297813231 | 317 | F-box family protein [Arabidopsis lyrata | 0.968 | 0.984 | 0.642 | 1e-111 | |
| 18413178 | 317 | F-box protein FBW2 [Arabidopsis thaliana | 0.968 | 0.984 | 0.645 | 1e-111 | |
| 359492882 | 296 | PREDICTED: F-box protein FBW2 [Vitis vin | 0.894 | 0.972 | 0.652 | 1e-106 | |
| 302141985 | 292 | unnamed protein product [Vitis vinifera] | 0.822 | 0.907 | 0.698 | 1e-100 | |
| 242065902 | 365 | hypothetical protein SORBIDRAFT_04g02735 | 0.981 | 0.865 | 0.594 | 4e-99 |
| >gi|224063261|ref|XP_002301066.1| predicted protein [Populus trichocarpa] gi|222842792|gb|EEE80339.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 473 bits (1217), Expect = e-131, Method: Compositional matrix adjust.
Identities = 242/324 (74%), Positives = 272/324 (83%), Gaps = 5/324 (1%)
Query: 1 MEGESEFRHWDELIPDALGLIFRNLSLQEVLTVIPGVCKSWRRAVIGPYCWQEIDIEEWS 60
ME E+R WDELIPDALGLIFRNLSLQE+LT++P VCKSW RAV GPYCWQEI+IEEWS
Sbjct: 1 MEEGDEYRRWDELIPDALGLIFRNLSLQEILTMVPRVCKSWSRAVSGPYCWQEINIEEWS 60
Query: 61 NRCQPDHLDRMVEMLITRSSGSLRKLCVSGLHNDMMFSLIAENAGSLQTLRLPRSEMSDS 120
RC PDHLDRM++MLITRS GSLRKLCVSGLHND FS +A++AGSLQTLR+PRS++ DS
Sbjct: 61 TRCHPDHLDRMLQMLITRSCGSLRKLCVSGLHNDTNFSFLADHAGSLQTLRIPRSDIGDS 120
Query: 121 IVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEA 180
IV QIAGRLS VTFLD+SYC+KI ALEAIGKHCKLLV LCRNMHPLDT +QDDEA
Sbjct: 121 IVEQIAGRLSTVTFLDVSYCNKISGRALEAIGKHCKLLVGLCRNMHPLDTEGLEAQDDEA 180
Query: 181 NAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGNFPNL 240
AIA+TMPKLKRLEMAYH++STE +L+ILSSC LEF+DLRGCW+V LD+KF K F L
Sbjct: 181 YAIATTMPKLKRLEMAYHLVSTESLLQILSSCTNLEFMDLRGCWNVNLDNKFFKEKFQKL 240
Query: 241 KVLGPFVM-DYYEINDW-DDCSDYSDGSEYLAWEFLAGEMGDYDDDDEIYEGMWDDEGRL 298
VLGP VM DYYE NDW +DCS+YSD S+YLAW FLA G DDDE Y+ MWDDEGRL
Sbjct: 241 TVLGPLVMEDYYEANDWEEDCSEYSDDSDYLAWGFLA-GDGGDYDDDESYDEMWDDEGRL 299
Query: 299 EELELRFYDGIEEDAGIYGWPPSP 322
EELELRFY+G DAG+YGWPPSP
Sbjct: 300 EELELRFYEGA--DAGLYGWPPSP 321
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356508073|ref|XP_003522785.1| PREDICTED: F-box protein FBW2-like isoform 1 [Glycine max] gi|356508075|ref|XP_003522786.1| PREDICTED: F-box protein FBW2-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255545780|ref|XP_002513950.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547036|gb|EEF48533.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449436998|ref|XP_004136279.1| PREDICTED: F-box protein FBW2-like [Cucumis sativus] gi|449524052|ref|XP_004169037.1| PREDICTED: F-box protein FBW2-like isoform 1 [Cucumis sativus] gi|449524054|ref|XP_004169038.1| PREDICTED: F-box protein FBW2-like isoform 2 [Cucumis sativus] gi|449524056|ref|XP_004169039.1| PREDICTED: F-box protein FBW2-like isoform 3 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225467167|ref|XP_002269291.1| PREDICTED: F-box protein FBW2 isoform 1 [Vitis vinifera] gi|359496684|ref|XP_003635300.1| PREDICTED: F-box protein FBW2 isoform 2 [Vitis vinifera] gi|296085646|emb|CBI29445.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297813231|ref|XP_002874499.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297320336|gb|EFH50758.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18413178|ref|NP_567343.1| F-box protein FBW2 [Arabidopsis thaliana] gi|30680931|ref|NP_849346.1| F-box protein FBW2 [Arabidopsis thaliana] gi|42572853|ref|NP_974523.1| F-box protein FBW2 [Arabidopsis thaliana] gi|145332987|ref|NP_001078359.1| F-box protein FBW2 [Arabidopsis thaliana] gi|238480265|ref|NP_001154215.1| F-box protein FBW2 [Arabidopsis thaliana] gi|75267749|sp|Q9ZPE4.1|FBW2_ARATH RecName: Full=F-box protein FBW2; AltName: Full=SKP1-interacting partner 18 gi|4325371|gb|AAD17367.1| contains similarity to Medicago truncatula N7 protein (GB:Y17613) [Arabidopsis thaliana] gi|7267540|emb|CAB78022.1| putative protein [Arabidopsis thaliana] gi|21536818|gb|AAM61150.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|27311651|gb|AAO00791.1| F-box protein family, AtFBW2 [Arabidopsis thaliana] gi|30984530|gb|AAP42728.1| At4g08980 [Arabidopsis thaliana] gi|222423880|dbj|BAH19904.1| AT4G08980 [Arabidopsis thaliana] gi|332657303|gb|AEE82703.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657304|gb|AEE82704.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657305|gb|AEE82705.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657306|gb|AEE82706.1| F-box protein FBW2 [Arabidopsis thaliana] gi|332657307|gb|AEE82707.1| F-box protein FBW2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359492882|ref|XP_002285756.2| PREDICTED: F-box protein FBW2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302141985|emb|CBI19188.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242065902|ref|XP_002454240.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] gi|241934071|gb|EES07216.1| hypothetical protein SORBIDRAFT_04g027350 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 322 | ||||||
| TAIR|locus:2122308 | 317 | FBW2 "AT4G08980" [Arabidopsis | 0.968 | 0.984 | 0.629 | 1.1e-103 | |
| TAIR|locus:2115949 | 302 | AT4G05460 "AT4G05460" [Arabido | 0.726 | 0.774 | 0.333 | 1.4e-25 | |
| TAIR|locus:1005716270 | 246 | AT4G05497 "AT4G05497" [Arabido | 0.695 | 0.910 | 0.306 | 8.3e-19 | |
| TAIR|locus:2115979 | 307 | AT4G05490 "AT4G05490" [Arabido | 0.689 | 0.723 | 0.293 | 4.6e-18 | |
| TAIR|locus:2174398 | 300 | SKIP1 "SKP1 interacting partne | 0.562 | 0.603 | 0.318 | 8.4e-14 | |
| TAIR|locus:2118736 | 301 | AT4G30640 "AT4G30640" [Arabido | 0.571 | 0.611 | 0.270 | 2.6e-08 | |
| TAIR|locus:2140715 | 220 | AT4G03630 "AT4G03630" [Arabido | 0.493 | 0.722 | 0.290 | 1.1e-07 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.633 | 0.482 | 0.257 | 2.9e-07 | |
| TAIR|locus:2099443 | 309 | AT3G48880 "AT3G48880" [Arabido | 0.655 | 0.682 | 0.262 | 2.7e-06 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.518 | 0.383 | 0.284 | 5.4e-06 |
| TAIR|locus:2122308 FBW2 "AT4G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1027 (366.6 bits), Expect = 1.1e-103, P = 1.1e-103
Identities = 206/327 (62%), Positives = 244/327 (74%)
Query: 1 MEGESEFRHWDELIPDALGLIFRNLSLQEVLTVIPGVCKSWRRAVIGPYCWQEIDIEEWS 60
ME + EFRHWDELIPDALGLIF +L LQEVLTV+P VCK+W RAV GPYCWQEIDIE WS
Sbjct: 1 MEEDCEFRHWDELIPDALGLIFSHLPLQEVLTVVPRVCKAWNRAVTGPYCWQEIDIELWS 60
Query: 61 NRC-QPDHLDRMVEMLITRSSGSLRKLCVSGLHNDMMFSLIAENAGSLQTLRLPRSEMSD 119
NR Q DHLDRM+EMLI RS+GSLRKL V+GL ND +FS IA++AGSL+TL++PRS +++
Sbjct: 61 NRFHQSDHLDRMLEMLIPRSAGSLRKLSVTGLRNDSIFSFIAQHAGSLKTLKVPRSGLTN 120
Query: 120 SIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDE 179
S V +A +LS++TFLDLSYC KIG A++AIGKHCK L CRNMHPLD A +S DDE
Sbjct: 121 SGVVNVAEKLSSLTFLDLSYCCKIGPEAIQAIGKHCKSLREFCRNMHPLDVASVVSHDDE 180
Query: 180 ANAIASTMPKLKRLEMAYHVISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGNFPN 239
A AIA+TMPKLKRLE+AYH +STE VLKILS C LEFL+LRGCWDV+LD+KF K FP+
Sbjct: 181 AYAIANTMPKLKRLEIAYHRVSTEGVLKILSCCVFLEFLELRGCWDVQLDNKFFKEKFPD 240
Query: 240 LKVLGPFVMDYYE-INDWDDC-SDY-SDGSEYLAWEFLAXXXXXXXXXXXXXXXXWDDEG 296
+KVLGP V+ +Y+ INDW+DC SDY SDGS+YLAWEF WDD
Sbjct: 241 MKVLGPRVIGFYDMINDWEDCCSDYFSDGSDYLAWEFFEDGVMGEFYEDEFEHG-WDDN- 298
Query: 297 RXXXXXXRFY-DGIEEDAGIYGWPPSP 322
FY + D + WPPSP
Sbjct: 299 --------FYAENAVLDMEPHIWPPSP 317
|
|
| TAIR|locus:2115949 AT4G05460 "AT4G05460" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716270 AT4G05497 "AT4G05497" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115979 AT4G05490 "AT4G05490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174398 SKIP1 "SKP1 interacting partner 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118736 AT4G30640 "AT4G30640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140715 AT4G03630 "AT4G03630" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099443 AT3G48880 "AT3G48880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_II0452 | SubName- Full=Putative uncharacterized protein; (322 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 322 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 1e-05 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 45.4 bits (108), Expect = 1e-05
Identities = 39/150 (26%), Positives = 59/150 (39%), Gaps = 16/150 (10%)
Query: 103 NAGSLQTLRLPRS-EMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVL 161
N L+ L LP S + D + +A + LDL C I + A+ +C L +
Sbjct: 50 NCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTI 109
Query: 162 ----CRNMHPLDTADKLSQDDEANAIASTMPKLKRLEMAYHVISTEIVLKILSSCAL-LE 216
RN H L D +A+ L+ + A ++ + V ++ S C+ LE
Sbjct: 110 NLGRHRNGH-------LITDVSLSALGKNCTFLQTVGFAGCDVTDKGVWELASGCSKSLE 162
Query: 217 FLDLRGCW---DVKLDDKFMKGNFPNLKVL 243
L L C D + FPNL VL
Sbjct: 163 RLSLNNCRNLTDQSIPAILASNYFPNLSVL 192
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.96 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.66 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.35 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.33 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.31 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.26 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.2 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.15 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.13 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.05 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.79 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.79 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.75 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.69 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.65 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.61 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.43 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.34 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 98.32 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.31 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.18 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.16 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.14 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.89 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.84 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.74 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.73 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.7 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.64 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.64 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 97.61 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.51 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 97.25 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.24 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.21 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 97.07 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.01 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 96.95 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.92 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 96.81 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.67 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 96.59 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.53 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 96.52 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.52 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.5 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.46 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.38 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.03 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 96.02 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.96 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.9 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.83 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 95.37 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.3 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.29 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 95.28 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.89 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.84 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 94.43 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 94.37 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 94.27 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 94.16 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 93.58 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.5 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 93.06 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 92.75 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.66 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.62 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 92.36 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 91.5 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 91.42 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 91.31 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 91.13 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 90.77 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.29 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 90.08 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 89.55 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 88.96 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 88.96 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 88.94 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 87.27 | |
| KOG3735 | 353 | consensus Tropomodulin and leiomodulin [Cytoskelet | 84.67 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 82.99 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 82.52 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 82.4 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 82.37 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 81.97 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 80.93 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.9e-29 Score=223.30 Aligned_cols=249 Identities=23% Similarity=0.358 Sum_probs=209.5
Q ss_pred cCCHHHHHHHHccCChHHHhhhhhhhhHHHHHHhcCCCceeeeccccccccCChhHHHHHHHHHHHhcCCCeeEEEecCC
Q 020736 12 ELIPDALGLIFRNLSLQEVLTVIPGVCKSWRRAVIGPYCWQEIDIEEWSNRCQPDHLDRMVEMLITRSSGSLRKLCVSGL 91 (322)
Q Consensus 12 ~LP~eiL~~IF~~L~~~~~l~~~~~VCk~W~~~~~~~~lw~~i~l~~~~~~~~~~~~~~~l~~l~~r~~~~l~~L~l~~~ 91 (322)
.||+|++.+||++|+.+.+.+ +++||+.|+..|.+...|+++++..+.. +.-.+++..++.|+++.++.|+++||
T Consensus 74 ~LPpEl~lkvFS~LDtksl~r-~a~~c~~~n~~AlD~~~~q~idL~t~~r----Dv~g~VV~~~~~Rcgg~lk~LSlrG~ 148 (483)
T KOG4341|consen 74 SLPPELLLKVFSMLDTKSLCR-AAQCCTMWNKLALDGSCWQHIDLFTFQR----DVDGGVVENMISRCGGFLKELSLRGC 148 (483)
T ss_pred cCCHHHHHHHHHHHhHHHHHH-HHHHHHHhhhhhhccccceeeehhcchh----cCCCcceehHhhhhcccccccccccc
Confidence 599999999999999999999 8999999999999999999999998743 34467889999999999999999998
Q ss_pred C--ChHHHHHHHHhCCCCCEEecCCC-CCCHHHHHHHHhcCCCccEEeccCCCCCCHHHHHHHHhcCCCcceeecccccc
Q 020736 92 H--NDMMFSLIAENAGSLQTLRLPRS-EMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPL 168 (322)
Q Consensus 92 ~--~~~~l~~l~~~~~~L~~L~L~~~-~i~~~~l~~l~~~~~~L~~L~l~~c~~i~~~~l~~l~~~c~~L~~L~l~~~~l 168 (322)
. .++.+..++.+|||+++|.+.+| .+|+..+..+++.|++|++|++..|..+|+..++.+++.||+|++|++++++.
T Consensus 149 r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~q 228 (483)
T KOG4341|consen 149 RAVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQ 228 (483)
T ss_pred ccCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCch
Confidence 7 48889999999999999999999 99999999999999999999999999999999999999999999999987753
Q ss_pred C-------------------CCCCCCC-chHHHHHHhcCCCCCEEEecCc-ccCHHHHHHHHhcCCCCCEEeecCCCCcC
Q 020736 169 D-------------------TADKLSQ-DDEANAIASTMPKLKRLEMAYH-VISTEIVLKILSSCALLEFLDLRGCWDVK 227 (322)
Q Consensus 169 ~-------------------~~~~~~~-~~~~~~l~~~~p~L~~L~L~~~-~i~~~~l~~i~~~~~~L~~L~L~~c~~~~ 227 (322)
. ..||... .+.+..++..++-+..+++..| .+||.++..+...|..|+.|+.++|..++
T Consensus 229 i~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~ 308 (483)
T KOG4341|consen 229 ISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDIT 308 (483)
T ss_pred hhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCc
Confidence 2 1233322 2234555667888888888776 48999999999999999999999998875
Q ss_pred CCh-HHHHhcCCCCeeeCC-------------cccCc--ccccccccCCCCCCc
Q 020736 228 LDD-KFMKGNFPNLKVLGP-------------FVMDY--YEINDWDDCSDYSDG 265 (322)
Q Consensus 228 ~~~-~~l~~~~~~Lk~L~~-------------~~~~~--~~~~d~~~c~~~td~ 265 (322)
... ..+.++|++|++|.+ +.+++ ++.+|+++|..++|.
T Consensus 309 d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~ 362 (483)
T KOG4341|consen 309 DEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDG 362 (483)
T ss_pred hHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhh
Confidence 222 456788999999864 12333 677888888888875
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 322 | ||||
| 1fs2_A | 272 | Insights Into Scf Ubiquitin Ligases From The Struct | 3e-06 | ||
| 1fqv_A | 336 | Insights Into Scf Ubiquitin Ligases From The Struct | 2e-05 |
| >pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272 | Back alignment and structure |
|
| >pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 322 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-25 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 5e-08 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 3e-16 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 8e-13 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-12 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 6e-10 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-09 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-16 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-05 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-05 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 2e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 5e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 103 bits (259), Expect = 1e-25
Identities = 59/256 (23%), Positives = 92/256 (35%), Gaps = 32/256 (12%)
Query: 9 HWDELIPDALGLIFRNLSLQEVLTVIPGVCKSWRRAVIGPYCWQEIDIEEWSNRCQPDHL 68
WD L + L IF L L E+L V GVCK W R WQ +D+ + PD
Sbjct: 8 SWDSLPDELLLGIFSCLCLPELLKV-SGVCKRWYRLASDESLWQTLDLTGKN--LHPDVT 64
Query: 69 DRMVEMLIT----------------RSSGSLRKLCVSGLH-NDMMFSLIAENAGSLQTLR 111
R++ + S ++ + +S I LQ L
Sbjct: 65 GRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS 124
Query: 112 LPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTA 171
L +SD IV +A + S + L+LS CS AL+ + C L L L
Sbjct: 125 LEGLRLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELN-----LSWC 178
Query: 172 DKLSQDDEANAIASTMPKLKRLEMA--YHVISTEIVLKILSSCALLEFLDLRGCWDVKLD 229
++ A+A + +L ++ + + ++ C L LDL V L
Sbjct: 179 FDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS--VMLK 236
Query: 230 DKFMK--GNFPNLKVL 243
+ + L+ L
Sbjct: 237 NDCFQEFFQLNYLQHL 252
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.96 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.89 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.86 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.6 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.59 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.58 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.55 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.5 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.39 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.37 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.36 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.34 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.31 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.25 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.22 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.18 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.09 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.06 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.0 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.99 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.93 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.91 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.88 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.87 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.86 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.83 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.71 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.71 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.7 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.69 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.69 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.68 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.68 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.65 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.61 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.58 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.58 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.57 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.56 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.56 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.54 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.54 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.54 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.54 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.53 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.51 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.51 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.49 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.49 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.48 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.48 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.47 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.47 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.47 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.45 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.45 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.44 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.44 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.43 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.41 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.41 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.41 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.4 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.4 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.39 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.39 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.37 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.35 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.34 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.34 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.34 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.33 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.33 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.3 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.3 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.29 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.28 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.27 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.26 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.26 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.25 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.24 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.24 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.22 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.22 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.2 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.2 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.19 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.19 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.18 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.17 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.17 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.16 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.15 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.12 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.11 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.11 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.1 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.1 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.1 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.08 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.08 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.03 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.02 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.02 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.02 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.01 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.0 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.0 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.99 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.99 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.98 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.98 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.98 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.96 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.94 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.92 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.92 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.88 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.88 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.86 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.85 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.84 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.81 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.78 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.66 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.59 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.58 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.54 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.53 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.47 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.47 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.45 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.4 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.32 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.27 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.27 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.14 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.95 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.94 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.81 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.8 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.78 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.63 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.3 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.15 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 94.88 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 94.66 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 93.65 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 90.38 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 85.88 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 84.78 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 83.34 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 82.03 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 80.15 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.96 E-value=2.3e-27 Score=215.39 Aligned_cols=230 Identities=24% Similarity=0.271 Sum_probs=178.6
Q ss_pred CCCCcccCCHHHHHHHHccCChHHHhhhhhhhhHHHHHHhcCCCceeeeccccccccCChhHHHHHHHHHHH--------
Q 020736 6 EFRHWDELIPDALGLIFRNLSLQEVLTVIPGVCKSWRRAVIGPYCWQEIDIEEWSNRCQPDHLDRMVEMLIT-------- 77 (322)
Q Consensus 6 ~~~~w~~LP~eiL~~IF~~L~~~~~l~~~~~VCk~W~~~~~~~~lw~~i~l~~~~~~~~~~~~~~~l~~l~~-------- 77 (322)
+.+.|++||+|++.+||++|+..++++ +++|||+|+.++.+|.+|+.+++..... .+..+..++...+.
T Consensus 5 ~~~~~~~LP~eil~~If~~L~~~d~~~-~~~vc~~W~~~~~~~~~~~~l~l~~~~~--~~~~~~~~~~~~l~~L~l~~n~ 81 (336)
T 2ast_B 5 PGVSWDSLPDELLLGIFSCLCLPELLK-VSGVCKRWYRLASDESLWQTLDLTGKNL--HPDVTGRLLSQGVIAFRCPRSF 81 (336)
T ss_dssp --CCSSSSCHHHHHHHHTTSCHHHHHH-TTSSCHHHHHHHTCSTTSSEEECTTCBC--CHHHHHHHHHTTCSEEECTTCE
T ss_pred ccCChhhCCHHHHHHHHHhCCHHHHHH-HHHHHHHHHHHhcCchhheeeccccccC--CHHHHHhhhhccceEEEcCCcc
Confidence 468899999999999999999999998 7999999999999999999999987543 23333322111000
Q ss_pred --------hcCCCeeEEEecCCC-ChHHHHHHHHhCCCCCEEecCCCCCCHHHHHHHHhcCCCccEEeccCCCCCCHHHH
Q 020736 78 --------RSSGSLRKLCVSGLH-NDMMFSLIAENAGSLQTLRLPRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPAL 148 (322)
Q Consensus 78 --------r~~~~l~~L~l~~~~-~~~~l~~l~~~~~~L~~L~L~~~~i~~~~l~~l~~~~~~L~~L~l~~c~~i~~~~l 148 (322)
....++++|+++++. ++..+..+...+++|++|+|.+|.+++.....+.. +++|++|++++|..+++.++
T Consensus 82 l~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~-~~~L~~L~L~~~~~l~~~~l 160 (336)
T 2ast_B 82 MDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFAL 160 (336)
T ss_dssp ECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHH
T ss_pred ccccchhhccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhc-CCCCCEEECCCCCCCCHHHH
Confidence 012567888887764 44557777788999999999999999887777654 89999999999778999888
Q ss_pred HHHHhcCCCcceeeccccccCCCCCCCCchHHHHHHhcCC-CCCEEEecCc--ccCHHHHHHHHhcCCCCCEEeecCCCC
Q 020736 149 EAIGKHCKLLVVLCRNMHPLDTADKLSQDDEANAIASTMP-KLKRLEMAYH--VISTEIVLKILSSCALLEFLDLRGCWD 225 (322)
Q Consensus 149 ~~l~~~c~~L~~L~l~~~~l~~~~~~~~~~~~~~l~~~~p-~L~~L~L~~~--~i~~~~l~~i~~~~~~L~~L~L~~c~~ 225 (322)
..+...|++|++|.++.+. .+.+.++..+...+| +|++|+|++| .+++.++..++..+++|++|++++|..
T Consensus 161 ~~~~~~~~~L~~L~l~~~~------~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~ 234 (336)
T 2ast_B 161 QTLLSSCSRLDELNLSWCF------DFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVM 234 (336)
T ss_dssp HHHHHHCTTCCEEECCCCT------TCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTT
T ss_pred HHHHhcCCCCCEEcCCCCC------CcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCc
Confidence 8888899999999765441 344455666667899 9999999999 688888888888999999999999976
Q ss_pred cCCChHHHHhcCCCCeeeCC
Q 020736 226 VKLDDKFMKGNFPNLKVLGP 245 (322)
Q Consensus 226 ~~~~~~~l~~~~~~Lk~L~~ 245 (322)
++.........+++|++|.+
T Consensus 235 l~~~~~~~l~~l~~L~~L~l 254 (336)
T 2ast_B 235 LKNDCFQEFFQLNYLQHLSL 254 (336)
T ss_dssp CCGGGGGGGGGCTTCCEEEC
T ss_pred CCHHHHHHHhCCCCCCEeeC
Confidence 64333333467788988864
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 322 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.85 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.76 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.09 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.06 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.0 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.97 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.95 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.95 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.91 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.87 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.81 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.79 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.68 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.66 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.65 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.54 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.48 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.46 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.37 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.37 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.3 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.26 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.17 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.98 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.96 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.93 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.83 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.66 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.64 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.61 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.58 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.53 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.37 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.35 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.21 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 96.98 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.87 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.32 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.17 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.14 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 95.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.29 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.21 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.85 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85 E-value=1.8e-20 Score=164.39 Aligned_cols=195 Identities=23% Similarity=0.236 Sum_probs=150.3
Q ss_pred ceeeeccccccccCChhHHHHHHHHHHH--h--------------cCCCeeEEEecCCC-ChHHHHHHHHhCCCCCEEec
Q 020736 50 CWQEIDIEEWSNRCQPDHLDRMVEMLIT--R--------------SSGSLRKLCVSGLH-NDMMFSLIAENAGSLQTLRL 112 (322)
Q Consensus 50 lw~~i~l~~~~~~~~~~~~~~~l~~l~~--r--------------~~~~l~~L~l~~~~-~~~~l~~l~~~~~~L~~L~L 112 (322)
+|+++|+..... .+..+.+++..... | ....+++|+++++. +...+..+..+|++|++|+|
T Consensus 1 LW~~lDLs~~~l--~~~~l~~l~~~~~~~lrl~~~~~~~~~~~~~~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L 78 (284)
T d2astb2 1 LWQTLDLTGKNL--HPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSL 78 (284)
T ss_dssp TSSEEECTTCBC--CHHHHHHHHHTTCSEEECTTCEECSCCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEEC
T ss_pred CcCEEECCCCCC--CchHHHHHHhccceEeeccccccccchhhhccCCCCCEEECCCCccCHHHHHHHHHhCCCcccccc
Confidence 699999986543 45655555442111 0 12358889998865 57778888999999999999
Q ss_pred CCCCCCHHHHHHHHhcCCCccEEeccCCCCCCHHHHHHHHhcCCCcceeeccccccCCCCCCCCchHHH-HHHhcCCCCC
Q 020736 113 PRSEMSDSIVAQIAGRLSAVTFLDLSYCSKIGAPALEAIGKHCKLLVVLCRNMHPLDTADKLSQDDEAN-AIASTMPKLK 191 (322)
Q Consensus 113 ~~~~i~~~~l~~l~~~~~~L~~L~l~~c~~i~~~~l~~l~~~c~~L~~L~l~~~~l~~~~~~~~~~~~~-~l~~~~p~L~ 191 (322)
.+|.+++..+..++ ++++|++|++++|..+++.++.++++.||+|++|+++.+. .+.+.++. .++..+++|+
T Consensus 79 ~~~~l~~~~~~~l~-~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~------~~~~~~~~~~~~~~~~~L~ 151 (284)
T d2astb2 79 EGLRLSDPIVNTLA-KNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCF------DFTEKHVQVAVAHVSETIT 151 (284)
T ss_dssp TTCBCCHHHHHHHT-TCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCT------TCCHHHHHHHHHHSCTTCC
T ss_pred cccCCCcHHHHHHh-cCCCCcCccccccccccccccchhhHHHHhcccccccccc------ccccccchhhhcccccccc
Confidence 99999999888875 5799999999999999999999999999999999765432 13445554 4555678999
Q ss_pred EEEecCc--ccCHHHHHHHHhcCCCCCEEeecCCCCcCCChHHHHhcCCCCeeeCCcccCcccccccccCCCCCC
Q 020736 192 RLEMAYH--VISTEIVLKILSSCALLEFLDLRGCWDVKLDDKFMKGNFPNLKVLGPFVMDYYEINDWDDCSDYSD 264 (322)
Q Consensus 192 ~L~L~~~--~i~~~~l~~i~~~~~~L~~L~L~~c~~~~~~~~~l~~~~~~Lk~L~~~~~~~~~~~d~~~c~~~td 264 (322)
+|+++++ .+++.++..++..||+|++|++++|..++.........+++|++|.+ ..|..++|
T Consensus 152 ~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L-----------~~C~~i~~ 215 (284)
T d2astb2 152 QLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSL-----------SRCYDIIP 215 (284)
T ss_dssp EEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEEC-----------TTCTTCCG
T ss_pred hhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCCEEEC-----------CCCCCCCh
Confidence 9999986 58999999999999999999999998886444333457888888843 56666665
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|