Query 020738
Match_columns 322
No_of_seqs 50 out of 52
Neff 3.0
Searched_HMMs 46136
Date Fri Mar 29 04:44:58 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020738.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/020738hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG4367 Predicted Zn-finger pr 34.6 36 0.00078 36.1 3.1 15 144-158 180-195 (699)
2 PF12315 DUF3633: Protein of u 29.6 43 0.00092 31.9 2.5 22 229-250 119-140 (212)
3 PF02257 RFX_DNA_binding: RFX 24.4 39 0.00085 27.7 1.1 11 148-158 72-82 (85)
4 PF06678 DUF1179: Protein of u 24.4 62 0.0013 27.9 2.3 13 1-13 1-13 (103)
5 KOG2164 Predicted E3 ubiquitin 14.8 1.1E+02 0.0024 32.6 2.1 47 44-95 165-220 (513)
6 PF08097 Toxin_26: Conotoxin T 14.7 66 0.0014 17.8 0.3 6 83-88 1-6 (11)
7 cd03035 ArsC_Yffb Arsenate Red 14.7 1.1E+02 0.0024 24.9 1.8 18 196-213 6-23 (105)
8 smart00082 LRRCT Leucine rich 13.0 1.2E+02 0.0025 20.7 1.2 13 231-243 5-18 (51)
9 cd03034 ArsC_ArsC Arsenate Red 12.9 1.4E+02 0.0029 24.5 1.8 55 196-251 6-65 (112)
10 TIGR00014 arsC arsenate reduct 12.7 1.4E+02 0.003 24.6 1.8 56 196-251 6-66 (114)
No 1
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=34.56 E-value=36 Score=36.11 Aligned_cols=15 Identities=40% Similarity=1.059 Sum_probs=13.7
Q ss_pred CCccccee-eeceeec
Q 020738 144 ASCDAILC-FCGIRLH 158 (322)
Q Consensus 144 ~tCD~vfC-yCGiRL~ 158 (322)
+.||+-|| -|..|+|
T Consensus 180 eqcdv~yc~pc~~~~h 195 (699)
T KOG4367|consen 180 EQCDVFYCDPCRLRCH 195 (699)
T ss_pred hhCceEEechHHhccC
Confidence 78999999 6999999
No 2
>PF12315 DUF3633: Protein of unknown function (DUF3633); InterPro: IPR022087 This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM.
Probab=29.59 E-value=43 Score=31.86 Aligned_cols=22 Identities=18% Similarity=0.283 Sum_probs=15.1
Q ss_pred cCcchhhhhhHHHhhccccccc
Q 020738 229 FSRDCQLMGLTWLLARNKTAYI 250 (322)
Q Consensus 229 ~~rDCqLMGLtWLLarN~T~Y~ 250 (322)
.+-=||+|+.+||-..-...++
T Consensus 119 EEGiCqvla~~wL~~~~~~~~~ 140 (212)
T PF12315_consen 119 EEGICQVLAYLWLESELASGSG 140 (212)
T ss_pred HHHHHHHHHHHHHhhhhhcccC
Confidence 3345999999999865443333
No 3
>PF02257 RFX_DNA_binding: RFX DNA-binding domain; InterPro: IPR003150 RFX is a regulatory factor which binds to the X box of MHC class II genes and is essential for their expression. The DNA-binding domain of RFX is the central domain of the protein and binds ssDNA as either a monomer or homodimer [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1DP7_P 2KW3_A.
Probab=24.44 E-value=39 Score=27.65 Aligned_cols=11 Identities=45% Similarity=1.035 Sum_probs=8.4
Q ss_pred cceeeeceeec
Q 020738 148 AILCFCGIRLH 158 (322)
Q Consensus 148 ~vfCyCGiRL~ 158 (322)
.=|||+|||+.
T Consensus 72 SkYhY~Gir~k 82 (85)
T PF02257_consen 72 SKYHYCGIRLK 82 (85)
T ss_dssp -EEEEEEEEE-
T ss_pred cceEEEeEEec
Confidence 45999999997
No 4
>PF06678 DUF1179: Protein of unknown function (DUF1179); InterPro: IPR009564 This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown.
Probab=24.42 E-value=62 Score=27.85 Aligned_cols=13 Identities=38% Similarity=0.603 Sum_probs=10.4
Q ss_pred CCChhhHHHHHHH
Q 020738 1 MPPFTFIFTLVIL 13 (322)
Q Consensus 1 ~~~~~~~~~~~~~ 13 (322)
|-.|+|||-.+++
T Consensus 1 m~~f~~i~~~i~l 13 (103)
T PF06678_consen 1 MFSFWFILKSIFL 13 (103)
T ss_pred CcchHHHHHHHHH
Confidence 6789999877766
No 5
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=14.84 E-value=1.1e+02 Score=32.58 Aligned_cols=47 Identities=21% Similarity=0.372 Sum_probs=39.4
Q ss_pred CCCccCCccccc---------cccCCCCCCccchhhhHhhhcCCCCCCCCcHHHHHHHHHH
Q 020738 44 TNTVPAFPAQTQ---------AATCRLDLSAELFGGVNEACGRDLDRSRCCPVLAAWLFAA 95 (322)
Q Consensus 44 ~~TiPAfPeqs~---------aa~CpLdlS~~lF~~V~saC~~~~~R~RCCPvLAAWL~aA 95 (322)
-++.|-+|++|+ ...||.=|.++.++..-. || +-.|||-|=.|+-.+
T Consensus 165 qn~dpD~p~~~e~i~qv~~~t~~~CPICL~~~~~p~~t~-CG----HiFC~~CiLqy~~~s 220 (513)
T KOG2164|consen 165 QNTDPDAPVDWEDIFQVYGSTDMQCPICLEPPSVPVRTN-CG----HIFCGPCILQYWNYS 220 (513)
T ss_pred hccCCccccchHHhhhhhcCcCCcCCcccCCCCcccccc-cC----ceeeHHHHHHHHhhh
Confidence 588999999999 679999999999988777 99 889999876655433
No 6
>PF08097 Toxin_26: Conotoxin T-superfamily; InterPro: IPR012631 This family consists of the T-superfamily of conotoxins. Eight different T-superfamily peptides from five Conus species were identified. These peptides share a consensus signal sequence, and a conserved arrangement of cysteine residues. T-superfamily peptides were found expressed in venom ducts of all major feeding types of Conus, suggesting that the T-superfamily is a large and diverse group of peptides, widely distributed in the 500 different Conus species [].; GO: 0005576 extracellular region
Probab=14.75 E-value=66 Score=17.80 Aligned_cols=6 Identities=67% Similarity=1.863 Sum_probs=4.4
Q ss_pred CCcHHH
Q 020738 83 RCCPVL 88 (322)
Q Consensus 83 RCCPvL 88 (322)
.|||++
T Consensus 1 fccpvi 6 (11)
T PF08097_consen 1 FCCPVI 6 (11)
T ss_pred CCcchh
Confidence 488876
No 7
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.
Probab=14.72 E-value=1.1e+02 Score=24.90 Aligned_cols=18 Identities=17% Similarity=0.261 Sum_probs=15.6
Q ss_pred CCChhHHHHHHHhhhCCC
Q 020738 196 YSGCTKCLGALQMLKGGS 213 (322)
Q Consensus 196 l~gCskCL~AL~~l~~~~ 213 (322)
..+|++|-+|+.+|+.++
T Consensus 6 ~~~C~~crka~~~L~~~~ 23 (105)
T cd03035 6 IKNCDTVKKARKWLEARG 23 (105)
T ss_pred CCCCHHHHHHHHHHHHcC
Confidence 468999999999998763
No 8
>smart00082 LRRCT Leucine rich repeat C-terminal domain.
Probab=12.99 E-value=1.2e+02 Score=20.66 Aligned_cols=13 Identities=54% Similarity=0.915 Sum_probs=10.6
Q ss_pred cchhhhhhH-HHhh
Q 020738 231 RDCQLMGLT-WLLA 243 (322)
Q Consensus 231 rDCqLMGLt-WLLa 243 (322)
=||+|+.+. |+.+
T Consensus 5 CdC~l~~~~~w~~~ 18 (51)
T smart00082 5 CDCELRWLLRWLQA 18 (51)
T ss_pred CcCCchHHHHHHHh
Confidence 399999887 8776
No 9
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.
Probab=12.93 E-value=1.4e+02 Score=24.45 Aligned_cols=55 Identities=16% Similarity=0.175 Sum_probs=30.8
Q ss_pred CCChhHHHHHHHhhhCCCCCCC---CcccccccccccCcchhhhh--hHHHhhccccccch
Q 020738 196 YSGCTKCLGALQMLKGGSKNGT---AEHEDNRASKMFSRDCQLMG--LTWLLARNKTAYIP 251 (322)
Q Consensus 196 l~gCskCL~AL~~l~~~~~~~n---~~~~~~r~~~~~~rDCqLMG--LtWLLarN~T~Y~~ 251 (322)
..+|++|-.|+++|+.++-.-. -.+..= +..+-.+=.+.+| +-=|+.++.+.|..
T Consensus 6 ~~~C~t~rkA~~~L~~~~i~~~~~di~~~~~-t~~el~~~l~~~~~~~~~lin~~~~~y~~ 65 (112)
T cd03034 6 NPRCSKSRNALALLEEAGIEPEIVEYLKTPP-TAAELRELLAKLGISPRDLLRTKEAPYKE 65 (112)
T ss_pred CCCCHHHHHHHHHHHHCCCCeEEEecccCCc-CHHHHHHHHHHcCCCHHHHHhcCCchHHH
Confidence 5789999999999997642110 000000 1112223345566 45677777777753
No 10
>TIGR00014 arsC arsenate reductase (glutaredoxin). composed of two polypeptides, the products of the arsA and arsB genes. The pump alone produces resistance to arsenite and antimonite. This protein, ArsC, catalyzes the reduction of arsenate to arsenite, and thus extends resistance to include arsenate.
Probab=12.71 E-value=1.4e+02 Score=24.55 Aligned_cols=56 Identities=16% Similarity=0.228 Sum_probs=31.0
Q ss_pred CCChhHHHHHHHhhhCCCCCCCCcc-cccc-cccccCcchhhhhhH-H--Hhhccccccch
Q 020738 196 YSGCTKCLGALQMLKGGSKNGTAEH-EDNR-ASKMFSRDCQLMGLT-W--LLARNKTAYIP 251 (322)
Q Consensus 196 l~gCskCL~AL~~l~~~~~~~n~~~-~~~r-~~~~~~rDCqLMGLt-W--LLarN~T~Y~~ 251 (322)
..+|++|-.|+.+|+..+..-..-. .++. +..+-.+=.+.+|+. | |+.++.+.|..
T Consensus 6 ~~~C~t~rkA~~~L~~~~i~~~~~di~~~p~t~~el~~~l~~~g~~~~~~lin~~~~~~~~ 66 (114)
T TIGR00014 6 NPRCSKSRNTLALLEDKGIEPEVVKYLKNPPTKSELEAIFAKLGLTVAREMIRTKEALYKE 66 (114)
T ss_pred CCCCHHHHHHHHHHHHCCCCeEEEeccCCCcCHHHHHHHHHHcCCchHHHHHhcCCcHHHH
Confidence 4789999999999987642110000 0000 111222224456763 3 88888887764
Done!