Query         020738
Match_columns 322
No_of_seqs    50 out of 52
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 04:44:58 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020738.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/020738hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4367 Predicted Zn-finger pr  34.6      36 0.00078   36.1   3.1   15  144-158   180-195 (699)
  2 PF12315 DUF3633:  Protein of u  29.6      43 0.00092   31.9   2.5   22  229-250   119-140 (212)
  3 PF02257 RFX_DNA_binding:  RFX   24.4      39 0.00085   27.7   1.1   11  148-158    72-82  (85)
  4 PF06678 DUF1179:  Protein of u  24.4      62  0.0013   27.9   2.3   13    1-13      1-13  (103)
  5 KOG2164 Predicted E3 ubiquitin  14.8 1.1E+02  0.0024   32.6   2.1   47   44-95    165-220 (513)
  6 PF08097 Toxin_26:  Conotoxin T  14.7      66  0.0014   17.8   0.3    6   83-88      1-6   (11)
  7 cd03035 ArsC_Yffb Arsenate Red  14.7 1.1E+02  0.0024   24.9   1.8   18  196-213     6-23  (105)
  8 smart00082 LRRCT Leucine rich   13.0 1.2E+02  0.0025   20.7   1.2   13  231-243     5-18  (51)
  9 cd03034 ArsC_ArsC Arsenate Red  12.9 1.4E+02  0.0029   24.5   1.8   55  196-251     6-65  (112)
 10 TIGR00014 arsC arsenate reduct  12.7 1.4E+02   0.003   24.6   1.8   56  196-251     6-66  (114)

No 1  
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=34.56  E-value=36  Score=36.11  Aligned_cols=15  Identities=40%  Similarity=1.059  Sum_probs=13.7

Q ss_pred             CCccccee-eeceeec
Q 020738          144 ASCDAILC-FCGIRLH  158 (322)
Q Consensus       144 ~tCD~vfC-yCGiRL~  158 (322)
                      +.||+-|| -|..|+|
T Consensus       180 eqcdv~yc~pc~~~~h  195 (699)
T KOG4367|consen  180 EQCDVFYCDPCRLRCH  195 (699)
T ss_pred             hhCceEEechHHhccC
Confidence            78999999 6999999


No 2  
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=29.59  E-value=43  Score=31.86  Aligned_cols=22  Identities=18%  Similarity=0.283  Sum_probs=15.1

Q ss_pred             cCcchhhhhhHHHhhccccccc
Q 020738          229 FSRDCQLMGLTWLLARNKTAYI  250 (322)
Q Consensus       229 ~~rDCqLMGLtWLLarN~T~Y~  250 (322)
                      .+-=||+|+.+||-..-...++
T Consensus       119 EEGiCqvla~~wL~~~~~~~~~  140 (212)
T PF12315_consen  119 EEGICQVLAYLWLESELASGSG  140 (212)
T ss_pred             HHHHHHHHHHHHHhhhhhcccC
Confidence            3345999999999865443333


No 3  
>PF02257 RFX_DNA_binding:  RFX DNA-binding domain;  InterPro: IPR003150 RFX is a regulatory factor which binds to the X box of MHC class II genes and is essential for their expression. The DNA-binding domain of RFX is the central domain of the protein and binds ssDNA as either a monomer or homodimer [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1DP7_P 2KW3_A.
Probab=24.44  E-value=39  Score=27.65  Aligned_cols=11  Identities=45%  Similarity=1.035  Sum_probs=8.4

Q ss_pred             cceeeeceeec
Q 020738          148 AILCFCGIRLH  158 (322)
Q Consensus       148 ~vfCyCGiRL~  158 (322)
                      .=|||+|||+.
T Consensus        72 SkYhY~Gir~k   82 (85)
T PF02257_consen   72 SKYHYCGIRLK   82 (85)
T ss_dssp             -EEEEEEEEE-
T ss_pred             cceEEEeEEec
Confidence            45999999997


No 4  
>PF06678 DUF1179:  Protein of unknown function (DUF1179);  InterPro: IPR009564 This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown.
Probab=24.42  E-value=62  Score=27.85  Aligned_cols=13  Identities=38%  Similarity=0.603  Sum_probs=10.4

Q ss_pred             CCChhhHHHHHHH
Q 020738            1 MPPFTFIFTLVIL   13 (322)
Q Consensus         1 ~~~~~~~~~~~~~   13 (322)
                      |-.|+|||-.+++
T Consensus         1 m~~f~~i~~~i~l   13 (103)
T PF06678_consen    1 MFSFWFILKSIFL   13 (103)
T ss_pred             CcchHHHHHHHHH
Confidence            6789999877766


No 5  
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=14.84  E-value=1.1e+02  Score=32.58  Aligned_cols=47  Identities=21%  Similarity=0.372  Sum_probs=39.4

Q ss_pred             CCCccCCccccc---------cccCCCCCCccchhhhHhhhcCCCCCCCCcHHHHHHHHHH
Q 020738           44 TNTVPAFPAQTQ---------AATCRLDLSAELFGGVNEACGRDLDRSRCCPVLAAWLFAA   95 (322)
Q Consensus        44 ~~TiPAfPeqs~---------aa~CpLdlS~~lF~~V~saC~~~~~R~RCCPvLAAWL~aA   95 (322)
                      -++.|-+|++|+         ...||.=|.++.++..-. ||    +-.|||-|=.|+-.+
T Consensus       165 qn~dpD~p~~~e~i~qv~~~t~~~CPICL~~~~~p~~t~-CG----HiFC~~CiLqy~~~s  220 (513)
T KOG2164|consen  165 QNTDPDAPVDWEDIFQVYGSTDMQCPICLEPPSVPVRTN-CG----HIFCGPCILQYWNYS  220 (513)
T ss_pred             hccCCccccchHHhhhhhcCcCCcCCcccCCCCcccccc-cC----ceeeHHHHHHHHhhh
Confidence            588999999999         679999999999988777 99    889999876655433


No 6  
>PF08097 Toxin_26:  Conotoxin T-superfamily;  InterPro: IPR012631 This family consists of the T-superfamily of conotoxins. Eight different T-superfamily peptides from five Conus species were identified. These peptides share a consensus signal sequence, and a conserved arrangement of cysteine residues. T-superfamily peptides were found expressed in venom ducts of all major feeding types of Conus, suggesting that the T-superfamily is a large and diverse group of peptides, widely distributed in the 500 different Conus species [].; GO: 0005576 extracellular region
Probab=14.75  E-value=66  Score=17.80  Aligned_cols=6  Identities=67%  Similarity=1.863  Sum_probs=4.4

Q ss_pred             CCcHHH
Q 020738           83 RCCPVL   88 (322)
Q Consensus        83 RCCPvL   88 (322)
                      .|||++
T Consensus         1 fccpvi    6 (11)
T PF08097_consen    1 FCCPVI    6 (11)
T ss_pred             CCcchh
Confidence            488876


No 7  
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine suggest that it is likely to function as a glutathione (GSH)-dependent thiol reductase. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from GSH via glutaredoxin, through a single catalytic cysteine.
Probab=14.72  E-value=1.1e+02  Score=24.90  Aligned_cols=18  Identities=17%  Similarity=0.261  Sum_probs=15.6

Q ss_pred             CCChhHHHHHHHhhhCCC
Q 020738          196 YSGCTKCLGALQMLKGGS  213 (322)
Q Consensus       196 l~gCskCL~AL~~l~~~~  213 (322)
                      ..+|++|-+|+.+|+.++
T Consensus         6 ~~~C~~crka~~~L~~~~   23 (105)
T cd03035           6 IKNCDTVKKARKWLEARG   23 (105)
T ss_pred             CCCCHHHHHHHHHHHHcC
Confidence            468999999999998763


No 8  
>smart00082 LRRCT Leucine rich repeat C-terminal domain.
Probab=12.99  E-value=1.2e+02  Score=20.66  Aligned_cols=13  Identities=54%  Similarity=0.915  Sum_probs=10.6

Q ss_pred             cchhhhhhH-HHhh
Q 020738          231 RDCQLMGLT-WLLA  243 (322)
Q Consensus       231 rDCqLMGLt-WLLa  243 (322)
                      =||+|+.+. |+.+
T Consensus         5 CdC~l~~~~~w~~~   18 (51)
T smart00082        5 CDCELRWLLRWLQA   18 (51)
T ss_pred             CcCCchHHHHHHHh
Confidence            399999887 8776


No 9  
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.
Probab=12.93  E-value=1.4e+02  Score=24.45  Aligned_cols=55  Identities=16%  Similarity=0.175  Sum_probs=30.8

Q ss_pred             CCChhHHHHHHHhhhCCCCCCC---CcccccccccccCcchhhhh--hHHHhhccccccch
Q 020738          196 YSGCTKCLGALQMLKGGSKNGT---AEHEDNRASKMFSRDCQLMG--LTWLLARNKTAYIP  251 (322)
Q Consensus       196 l~gCskCL~AL~~l~~~~~~~n---~~~~~~r~~~~~~rDCqLMG--LtWLLarN~T~Y~~  251 (322)
                      ..+|++|-.|+++|+.++-.-.   -.+..= +..+-.+=.+.+|  +-=|+.++.+.|..
T Consensus         6 ~~~C~t~rkA~~~L~~~~i~~~~~di~~~~~-t~~el~~~l~~~~~~~~~lin~~~~~y~~   65 (112)
T cd03034           6 NPRCSKSRNALALLEEAGIEPEIVEYLKTPP-TAAELRELLAKLGISPRDLLRTKEAPYKE   65 (112)
T ss_pred             CCCCHHHHHHHHHHHHCCCCeEEEecccCCc-CHHHHHHHHHHcCCCHHHHHhcCCchHHH
Confidence            5789999999999997642110   000000 1112223345566  45677777777753


No 10 
>TIGR00014 arsC arsenate reductase (glutaredoxin). composed of two polypeptides, the products of the arsA and arsB genes. The pump alone produces resistance to arsenite and antimonite. This protein, ArsC, catalyzes the reduction of arsenate to arsenite, and thus extends resistance to include arsenate.
Probab=12.71  E-value=1.4e+02  Score=24.55  Aligned_cols=56  Identities=16%  Similarity=0.228  Sum_probs=31.0

Q ss_pred             CCChhHHHHHHHhhhCCCCCCCCcc-cccc-cccccCcchhhhhhH-H--Hhhccccccch
Q 020738          196 YSGCTKCLGALQMLKGGSKNGTAEH-EDNR-ASKMFSRDCQLMGLT-W--LLARNKTAYIP  251 (322)
Q Consensus       196 l~gCskCL~AL~~l~~~~~~~n~~~-~~~r-~~~~~~rDCqLMGLt-W--LLarN~T~Y~~  251 (322)
                      ..+|++|-.|+.+|+..+..-..-. .++. +..+-.+=.+.+|+. |  |+.++.+.|..
T Consensus         6 ~~~C~t~rkA~~~L~~~~i~~~~~di~~~p~t~~el~~~l~~~g~~~~~~lin~~~~~~~~   66 (114)
T TIGR00014         6 NPRCSKSRNTLALLEDKGIEPEVVKYLKNPPTKSELEAIFAKLGLTVAREMIRTKEALYKE   66 (114)
T ss_pred             CCCCHHHHHHHHHHHHCCCCeEEEeccCCCcCHHHHHHHHHHcCCchHHHHHhcCCcHHHH
Confidence            4789999999999987642110000 0000 111222224456763 3  88888887764


Done!