Citrus Sinensis ID: 020752


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MGAPKQKWTAEEEAALKAGVRKHGTGKWRTILSDPEFSAILHSRSNVDLKDKWRNINVTAIWGSRQKAKLALKKTSLTPKLDGRTPVIPKHDGRTPVTPKQDGRTQMTPKHDDNTIALSTAPQNDEVVDAKPLAISSGTMQASGSKEPVARLDKLILEAISNLKEPNGSDRASIASYIEDQYWAPANLRKLLATKLKFLSANGTLIKAKHKYRITPNTPVSVPKRSPKLLLEGRQKGSPKAQKKEINILTKSLVDADLSRMRGMTAQEAAAAAAQAIAEAEVAIAEAEEAAREAERAEAEAEAAQVFAKAAIKALKCRALHT
cccccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
******KWTAEEEAALKAGVRKHGTGKWRTILSDPEFSAILHSRSNVDLKDKWRNINVTAI**************************************************************************************PVARLDKLILEAISN******SDRASIASYIEDQYWAPANLRKLLATKLKFLSANGTLIKAKHKYRIT*********************************************************AAQAIAEAEVAIAEAE*************EAAQVFAKAAIKALKCRAL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAPKQKWTAEEEAALKAGVRKHGTGKWRTILSDPEFSAILHSRSNVDLKDKWRNINVTAIWGSRQKAKLALKKTSLTPKLDGRTPVIPKHDGRTPVTPKQDGRTQMTPKHDDNTIALSTAPQNDEVVDAKPLAISSGTMQASGSKEPVARLDKLILEAISNLKEPNGSDRASIASYIEDQYWAPANLRKLLATKLKFLSANGTLIKAKHKYRITPNTPVSVPKRSPKLLLEGRQKGSPKAQKKEINILTKSLVDADLSRMRGMTAQEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKAAIKALKCRALHT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Telomere repeat-binding factor 2 Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand.probableQ9FJW5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ITY, chain A
Confidence level:very confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL
Template: 1HST, chain A
Confidence level:confident
Coverage over the Query: 148-216
View the alignment between query and template
View the model in PyMOL