Citrus Sinensis ID: 020757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MDETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTVFSAPNYCGEFDNAGAMMSVDDTLTCSFQILKASEKKGKVGFGNNMLRPGTPPHKGGKG
cccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccEEEcccEEEEccccccccccHHHHHcccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccHHccccccEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccc
*DETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTVFSAPNYCGEFDNAGAMMSVDDTLTCSFQILKA**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDETVLDDIIRRLLDAKNGRTTKQVQLTEAEIRQLCAASKEIFLSQPNLLELEAPIKICGDVHGQFSDLLRLFEYGGYPPEANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRGNHECASINRIYGFYDECKRRFNVRVWKTFTDCFNCLPVAALVDEKILCMHGGLSPDLKNLDQIRNIARPVDVPDQGLLCDLLWADPDKDIEGWGENDRGVSYTFGADKVVEFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTVFSAPNYCGEFDNAGAMMSVDDTLTCSFQILKASEKKGKVGFGNNMLRPGTPPHKGGKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase PP1-beta catalytic subunit Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.confidentP61292
Serine/threonine-protein phosphatase beta isoform Required for cell adhesion in non-muscle tissues and in maintenance of muscle attachment. Vital for larval development.confidentP48462
Serine/threonine-protein phosphatase PP1-beta catalytic subunit Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.confidentP62143

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 5-297
View the alignment between query and template
View the model in PyMOL