BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020759
         (321 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VBV|A Chain A, Crystal Structure Of Hypothetical Protein From Esherichia
           Coli
          Length = 105

 Score = 32.0 bits (71), Expect = 0.44,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 208 FRLGQKVNHKIFGYRAVICGMDPVCCESS-SWMEIAQVEKLQQGP 251
           F +GQ+V H + GY  V+  +DPV   S  S  E+A  ++L+  P
Sbjct: 6   FGIGQQVRHSLLGYLGVVVDIDPVYSLSEPSPDELAVNDELRAAP 50


>pdb|1DP4|A Chain A, Dimerized Hormone Binding Domain Of The Atrial Natriuretic
           Peptide Receptor
 pdb|1DP4|C Chain C, Dimerized Hormone Binding Domain Of The Atrial Natriuretic
           Peptide Receptor
 pdb|1T34|A Chain A, Rotation Mechanism For Transmembrane Signaling By The
           Atrial Natriuretic Peptide Receptor
 pdb|1T34|B Chain B, Rotation Mechanism For Transmembrane Signaling By The
           Atrial Natriuretic Peptide Receptor
 pdb|3A3K|A Chain A, Reversibly Bound Chloride In The Atrial Natriuretic
           Peptide Receptor Hormone-Binding Domain
 pdb|3A3K|B Chain B, Reversibly Bound Chloride In The Atrial Natriuretic
           Peptide Receptor Hormone-Binding Domain
          Length = 435

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 25  WRRHFKLLEKSRIGIDRPCFCHQFVQGLHLRVTFNLLRQR-NLRANAGWLFKGGSDR 80
           W     +L   R+G DRPCF    V+GL++RV     R+R N+  N     +G  D 
Sbjct: 146 WEHQALVLYADRLGDDRPCFF--IVEGLYMRV-----RERLNITVNHQEFVEGDPDH 195


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,586,662
Number of Sequences: 62578
Number of extensions: 259847
Number of successful extensions: 657
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 655
Number of HSP's gapped (non-prelim): 11
length of query: 321
length of database: 14,973,337
effective HSP length: 99
effective length of query: 222
effective length of database: 8,778,115
effective search space: 1948741530
effective search space used: 1948741530
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)