Citrus Sinensis ID: 020791

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MFFDGYGYHGTSFEQSYRCYPASFIEKPQIESGDKIIMPPSALDRLASLHIDYPMLFELRNNAAERVSHCGVLEFIAEEGMIYMPYWMMENLLLQEGDIVRVKNVTLPKGTYVKLQPHTKDFLDISNPKAILETTLRNYSCLTTGDSIMVAYNNKKYYIDIIETKPSNAISIIETDCEVDFAPPLDYKEPEKPIASASSRATAKAEEASVETEPKFSPFTGVARRLDGKPLTYQPPPVPSLGSKDKQPATSNGTGQPSAGSTSQNAARQSQGKLVFGSNASLHPKETQKPVAEKEIKQELPEKKEEPKFRPFTGKKYSLKG

ccccccccccccccEEEEEEEcccccccccccccEEECcHHHHHHHHHccccccEEEEEEccccccEEEEEEEEEEccccEEEEcHHHHHHcccccccEEEEEEECccccEEEEEECcccccccccccHHHHHccccccEEEccccEEEEEEccEEEEEEEEEEcccccEEEEEccCEEECccccccccccccccccccHHHHHHccccccccccccccCEEEEECccCCccccccccccccccccccccccccccccccccccccccccccCEEEECccccccccccccccHHHcccccccccccccccccccccccccc

**F*GYGYHGTSFEQSYRCYPASFIEKPQIESGDKIIMPPSALDRLASLHIDYPMLFELRNNAAERVSHCGVLEFIAEEGMIYMPYWMMENLLLQEGDIVRVKNVTLPKGTYVKLQPHTKDFLDISNPKAILETTLRNYSCLTTGDSIMVAYNNKKYYIDIIETKPSNAISIIETDCEVDFAPPL***************************************************************************************KLVFGSN***********************************KKYSL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquitin fusion degradation protein 1 homolog	Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures.	probable	Q92890
Ubiquitin fusion degradation protein 1 homolog	Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). It may be involved in the development of some ectoderm-derived structures.	probable	P70362
Ubiquitin fusion degradation protein 1 homolog	Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures.	probable	Q9ES53

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZC1, chain A
Confidence level:very confident
Coverage over the Query: 10-193
View the alignment between query and template
View the model in PyMOL