BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020793
         (321 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3C37|A Chain A, X-ray Structure Of The Putative Zn-dependent Peptidase
           Q74d82 At The Resolution 1.7 A. Northeast Structural
           Genomics Consortium Target Gsr143a
 pdb|3C37|B Chain B, X-ray Structure Of The Putative Zn-dependent Peptidase
           Q74d82 At The Resolution 1.7 A. Northeast Structural
           Genomics Consortium Target Gsr143a
          Length = 253

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 268 VVNEPVINAFCLPGGKIVVFTGLLEHFRTDAEIATIIGHE 307
           VV +  +NAF +PGG++ V TGLL+    + E+A ++ HE
Sbjct: 68  VVKDDSVNAFAIPGGRVYVHTGLLKAADNETELAGVLAHE 107


>pdb|3AX6|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole
           Ribonucleotide Synthetase From Thermotoga Maritima
 pdb|3AX6|B Chain B, Crystal Structure Of N5-Carboxyaminoimidazole
           Ribonucleotide Synthetase From Thermotoga Maritima
 pdb|3AX6|C Chain C, Crystal Structure Of N5-Carboxyaminoimidazole
           Ribonucleotide Synthetase From Thermotoga Maritima
 pdb|3AX6|D Chain D, Crystal Structure Of N5-Carboxyaminoimidazole
           Ribonucleotide Synthetase From Thermotoga Maritima
          Length = 380

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 115 YLGNLETVPYTKRTHFVLLSKAVERQL 141
           + G  ET PY K  HF ++ + VER L
Sbjct: 332 FYGKKETRPYRKXGHFTVVDRDVERAL 358


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.134    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,649,342
Number of Sequences: 62578
Number of extensions: 397546
Number of successful extensions: 866
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 863
Number of HSP's gapped (non-prelim): 6
length of query: 321
length of database: 14,973,337
effective HSP length: 99
effective length of query: 222
effective length of database: 8,778,115
effective search space: 1948741530
effective search space used: 1948741530
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)