BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020793
(321 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3C37|A Chain A, X-ray Structure Of The Putative Zn-dependent Peptidase
Q74d82 At The Resolution 1.7 A. Northeast Structural
Genomics Consortium Target Gsr143a
pdb|3C37|B Chain B, X-ray Structure Of The Putative Zn-dependent Peptidase
Q74d82 At The Resolution 1.7 A. Northeast Structural
Genomics Consortium Target Gsr143a
Length = 253
Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust.
Identities = 17/40 (42%), Positives = 27/40 (67%)
Query: 268 VVNEPVINAFCLPGGKIVVFTGLLEHFRTDAEIATIIGHE 307
VV + +NAF +PGG++ V TGLL+ + E+A ++ HE
Sbjct: 68 VVKDDSVNAFAIPGGRVYVHTGLLKAADNETELAGVLAHE 107
>pdb|3AX6|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole
Ribonucleotide Synthetase From Thermotoga Maritima
pdb|3AX6|B Chain B, Crystal Structure Of N5-Carboxyaminoimidazole
Ribonucleotide Synthetase From Thermotoga Maritima
pdb|3AX6|C Chain C, Crystal Structure Of N5-Carboxyaminoimidazole
Ribonucleotide Synthetase From Thermotoga Maritima
pdb|3AX6|D Chain D, Crystal Structure Of N5-Carboxyaminoimidazole
Ribonucleotide Synthetase From Thermotoga Maritima
Length = 380
Score = 27.7 bits (60), Expect = 7.9, Method: Compositional matrix adjust.
Identities = 12/27 (44%), Positives = 16/27 (59%)
Query: 115 YLGNLETVPYTKRTHFVLLSKAVERQL 141
+ G ET PY K HF ++ + VER L
Sbjct: 332 FYGKKETRPYRKXGHFTVVDRDVERAL 358
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.134 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,649,342
Number of Sequences: 62578
Number of extensions: 397546
Number of successful extensions: 866
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 863
Number of HSP's gapped (non-prelim): 6
length of query: 321
length of database: 14,973,337
effective HSP length: 99
effective length of query: 222
effective length of database: 8,778,115
effective search space: 1948741530
effective search space used: 1948741530
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)