Citrus Sinensis ID: 020795


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MTIPAELESSLRLKTVHHFVTQRPWLDLYGINVRPVAPFGSVSRKPYVDTALIHRCLPDELLFEVFARMSPYDLGKASCVCRKWKYTIRNPVFWRNACLKAWQLSGVVENYKILQSRYEGSWRKMWLLRPRIRIDGLYVSRNTYIRAGVAEWKITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSEEKVEAAVLYPGLRPTVLRIRLRLRGTTAGANNRMDLLSLVTSGMNDNEVNGHDEDILGVVEGWQDDETHNPDVPAVSHKRGLTPFVFVPFEEVETSVLNLPVEKMDYYVPG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHcHHHHHHccccHHHHHHHHHHccccccHHHHHHccccccHHHHHHHHHccccccccEEEEccEEEEcccccccccccEEEEEEEEEEEECccccEEEEEccccHHHHHHHHcccccccccEEEEEEEECccEEEEEEEccccccEEEEEEEEEcccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccc
**********LRLKTVHHFVTQRPWLDLYGINVRPVAPFGSVSRKPYVDTALIHRCLPDELLFEVFARMSPYDLGKASCVCRKWKYTIRNPVFWRNACLKAWQLSGVVENYKILQSRYEGSWRKMWLLRPRIRIDGLYVSRNTYIRAGVAEWKITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSEEKVEAAVLYPGLRPTVLRIRLRLRGTTAGANNRMDLLSLVTSGMNDNEVNGHDEDILGVVEGWQD*******VPAVSHKRGLTPFVFVPFEEVETSVLNLPVEKMDYYVPG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIPAELESSLRLKTVHHFVTQRPWLDLYGINVRPVAPFGSVSRKPYVDTALIHRCLPDELLFEVFARMSPYDLGKASCVCRKWKYTIRNPVFWRNACLKAWQLSGVVENYKILQSRYEGSWRKMWLLRPRIRIDGLYVSRNTYIRAGVAEWKITNPVHIVCYYRYMRFFPSGRFIYKNSSQKIKDVAKIMNFRAAKADCVFTGHYTLSEEKVEAAVLYPGLRPTVLRIRLRLRGTTAGANNRMDLLSLVTSGMNDNEVNGHDEDILGVVEGWQDDETHNPDVPAVSHKRGLTPFVFVPFEEVETSVLNLPVEKMDYYVPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein 7 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Required for efficient protein synthesis during temperature stress conditions.confidentQ9XI00

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E31, chain A
Confidence level:confident
Coverage over the Query: 53-105,117-133
View the alignment between query and template
View the model in PyMOL