Citrus Sinensis ID: 020820

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MSKDDDGPARLTSGSRSYKWVTNFQRDLMAGAVMGGFVHTIVAPIERAKLLLQTQESNLAIVGSGRRRFKGMLDCIARTVREEGILSLWRGNGSSVLRYYPSVALNFSLKDLYRNVLRNGNYQDGTSFMSGTSANFVAGAAAGCTTLILIYPLDIAHTRLAADVGRTDARQFRGFCHFLTTIFKKDGIRGVYRGLPASLQGMVVHRGLYFGGFDTMKEVLSEESKPELALWKRWVVAQAVTTSAGLLSYPLDTVRRRMMMQSGLEQPMYHNTLECWRTIYRKEGVTSFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGRL
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccHHcccHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccccEEccHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHcHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHccccc
************************QRDLMAGAVMGGFVHTIVAPIERAKLLLQTQESNLAIVGSGRRRFKGMLDCIARTVREEGILSLWRGNGSSVLRYYPSVALNFSLKDLYRNVLRNGNYQDGTSFMSGTSANFVAGAAAGCTTLILIYPLDIAHTRLAADVGRTDARQFRGFCHFLTTIFKKDGIRGVYRGLPASLQGMVVHRGLYFGGFDTMKEVLSEESKPELALWKRWVVAQAVTTSAGLLSYPLDTVRRRMMMQSGLEQPMYHNTLECWRTIYRKEGVTSFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGRL
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKDDDGPARLTSGSRSYKWVTNFQRDLMAGAVMGGFVHTIVAPIERAKLLLQTQESNLAIVGSGRRRFKGMLDCIARTVREEGILSLWRGNGSSVLRYYPSVALNFSLKDLYRNVLRNGNYQDGTSFMSGTSANFVAGAAAGCTTLILIYPLDIAHTRLAADVGRTDARQFRGFCHFLTTIFKKDGIRGVYRGLPASLQGMVVHRGLYFGGFDTMKEVLSEESKPELALWKRWVVAQAVTTSAGLLSYPLDTVRRRMMMQSGLEQPMYHNTLECWRTIYRKEGVTSFYRGAVSNMFRSTGAAAILVLYDEVKKFMNWGRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ADP,ATP carrier protein At5g56450 Catalyzes the exchange of ADP and ATP across the membrane.confidentQ9FM86
ADP,ATP carrier protein Catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane.probableP49382
ADP/ATP translocase 2 Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.probableQ8SQH5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 26-317
View the alignment between query and template
View the model in PyMOL