Citrus Sinensis ID: 020826

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MFRGHVMVIYWCVWFINREQDDYEVVRKVGRGKYSEVFEGVHCTDNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNTDFKVLYPTLSDYDVRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHEQRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDLWSLGCMFAGMIFRKEPFFYGHDNYDQLVKIAKVLGTDELNAYLNKYHIELDPHLAALVGRHSRKPWSKFITVENQHLAVPEAVDFLDKLLRYDHQERPTAKEAMAHPYFFPIRNAESSRSRS

cccccEEEEEEEEEcccccccccEEEEEEEccccEEEEEEEEcccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEcEEEEcccccccEEEEEccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccccccEEEEEcccccccccccccEEEEEcccccccHHccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHcccccccccccccccccc

***GHVMVIYWCVWFINREQDDYEVVRKVGRGKYSEVFEGVHCTDNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQQSKTPSLIFEHVNNTDFKVLYPTLSDYDVRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHEQRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDLWSLGCMFAGMIFRKEPFFYGHDNYDQLVKIAKVLGTDELNAYLNKYHIELDPHLAALVGRHSRKPWSKFITVENQHLAVPEAVDFLDKLLRYDHQERPTAKEAMAHPYFFP***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Casein kinase II subunit alpha	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha chain contains the catalytic site. May participate in Wnt signaling. Modulates two aspects of male mating behavior; response to hermaphrodite contact and vulval location, acting in the same pathway as lov-1 and pkd-2.	confident	P18334
Casein kinase II subunit alpha, chloroplastic	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha chain contains the catalytic site. May act as an ectokinase that phosphorylates several extracellular proteins.	confident	O64816
Casein kinase II subunit alpha	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha chain contains the catalytic site. May participate in Wnt signaling.	confident	P08181

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NSZ, chain A
Confidence level:very confident
Coverage over the Query: 19-312
View the alignment between query and template
View the model in PyMOL