BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 020834
(321 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3A6N|D Chain D, The Nucleosome Containing A Testis-Specific Histone
Variant, Human H3t
pdb|3A6N|H Chain H, The Nucleosome Containing A Testis-Specific Histone
Variant, Human H3t
pdb|3AFA|D Chain D, The Human Nucleosome Structure
pdb|3AFA|H Chain H, The Human Nucleosome Structure
pdb|3AV1|D Chain D, The Human Nucleosome Structure Containing The Histone
Variant H3.2
pdb|3AV1|H Chain H, The Human Nucleosome Structure Containing The Histone
Variant H3.2
pdb|3AV2|D Chain D, The Human Nucleosome Structure Containing The Histone
Variant H3.3
pdb|3AV2|H Chain H, The Human Nucleosome Structure Containing The Histone
Variant H3.3
pdb|3AYW|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k56q Mutation
pdb|3AYW|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k56q Mutation
pdb|3AZE|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k64q Mutation
pdb|3AZE|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k64q Mutation
pdb|3AZF|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k79q Mutation
pdb|3AZF|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k79q Mutation
pdb|3AZG|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k115q Mutation
pdb|3AZG|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k115q Mutation
pdb|3AZH|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k122q Mutation
pdb|3AZH|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H3k122q Mutation
pdb|3AZI|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k31q Mutation
pdb|3AZI|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k31q Mutation
pdb|3AZJ|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k44q Mutation
pdb|3AZJ|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k44q Mutation
pdb|3AZK|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k59q Mutation
pdb|3AZK|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k59q Mutation
pdb|3AZL|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k77q Mutation
pdb|3AZL|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k77q Mutation
pdb|3AZM|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k79q Mutation
pdb|3AZM|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k79q Mutation
pdb|3AZN|D Chain D, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k91q Mutation
pdb|3AZN|H Chain H, Crystal Structure Of Human Nucleosome Core Particle
Containing H4k91q Mutation
Length = 129
Score = 28.9 bits (63), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 5/93 (5%)
Query: 127 IEEAEPKDSKNPKRGKIAEVLIFIYEKLKLKQILQPPIIASILAMGI--GAVPFLKKLIF 184
+ +A+ KD K KR + I++Y+ LK + P S AMGI V + + I
Sbjct: 22 VTKAQKKDGKKRKRSRKESYSIYVYKVLKQ---VHPDTGISSKAMGIMNSFVNDIFERIA 78
Query: 185 TDDAPLFFFTDSCIILGEAMIPCILLALGGNLV 217
+ + L + I + + L L G L
Sbjct: 79 GEASRLAHYNKRSTITSREIQTAVRLLLPGELA 111
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.141 0.425
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,833,893
Number of Sequences: 62578
Number of extensions: 407550
Number of successful extensions: 633
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 627
Number of HSP's gapped (non-prelim): 6
length of query: 321
length of database: 14,973,337
effective HSP length: 99
effective length of query: 222
effective length of database: 8,778,115
effective search space: 1948741530
effective search space used: 1948741530
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)