Citrus Sinensis ID: 020881

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MEQRVREEQMGGEEQGRARACEKCAAGYYAICTIGGMLSAGTTHLVTTPLDVLKVNMQVNPLKYYGMSSGFSTLWKEQGSSSLWKGWSAKFCGYGVQGGCKFGLYEYFKSLYPDILVDYNRTFIFFLSSASAQVFADIALCPFESVKVRVQAQPHFAKGLSDGFPKVYKTEGLAGFYRGLFPLWCRNLPFSMIMFSTFEHSVDFIYQKLVQKRKEDCSRVQQLGVTCLAGYTAGAVGTLISNPADNIVASLYNKKAENVLQAVKKIGFLNLFTRSLPVRITIVGPVVTLQWFLYDSIKVLNGLPTSGGFCRRVEEANLSA
ccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccc
**********************KCAAGYYAICTIGGMLSAGTTHLVTTPLDVLKVNMQVNPLKYYGMSSGFSTLWKEQGSSSLWKGWSAKFCGYGVQGGCKFGLYEYFKSLYPDILVDYNRTFIFFLSSASAQVFADIALCPFESVKVRVQAQPHFAKGLSDGFPKVYKTEGLAGFYRGLFPLWCRNLPFSMIMFSTFEHSVDFIYQKLVQKRKEDCSRVQQLGVTCLAGYTAGAVGTLISNPADNIVASLYNKKAENVLQAVKKIGFLNLFTRSLPVRITIVGPVVTLQWFLYDSIKVLNGLPTS**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQRVREEQMGGEEQGRARACEKCAAGYYAICTIGGMLSAGTTHLVTTPLDVLKVNMQVNPLKYYGMSSGFSTLWKEQGSSSLWKGWSAKFCGYGVQGGCKFGLYEYFKSLYPDILVDYNRTFIFFLSSASAQVFADIALCPFESVKVRVQAQPHFAKGLSDGFPKVYKTEGLAGFYRGLFPLWCRNLPFSMIMFSTFEHSVDFIYQKLVQKRKEDCSRVQQLGVTCLAGYTAGAVGTLISNPADNIVASLYNKKAENVLQAVKKIGFLNLFTRSLPVRITIVGPVVTLQWFLYDSIKVLNGLPTSGGFCRRVEEANLSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial phosphate carrier protein 1, mitochondrial Transport of phosphate groups from the cytosol to the mitochondrial matrix. Mediates salt stress tolerance through an ATP-dependent pathway and via modulation of the gibberellin metabolism.confidentQ7DNC3
Mitochondrial substrate carrier family protein N Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. Transports phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).probableQ54BF6
Phosphate carrier protein, mitochondrial Transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+).probableQ00325

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 32-303
View the alignment between query and template
View the model in PyMOL