Query         020890
Match_columns 320
No_of_seqs    229 out of 550
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 05:58:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/020890.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/020890hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd06160 S2P-M50_like_2 Unchara  99.8 9.2E-21   2E-25  170.0  13.4  128  162-318     2-131 (183)
  2 cd06164 S2P-M50_SpoIVFB_CBS Sp  99.6   2E-14 4.4E-19  132.6  14.2  111  188-318    41-151 (227)
  3 cd06161 S2P-M50_SpoIVFB SpoIVF  99.5 2.6E-13 5.7E-18  123.2  10.9  109  188-318    26-134 (208)
  4 cd05709 S2P-M50 Site-2 proteas  99.3 4.1E-12   9E-17  111.4   9.6  114  194-319     2-137 (180)
  5 cd06163 S2P-M50_PDZ_RseP-like   99.2 1.7E-10 3.6E-15  103.8  10.2   78  194-272     3-111 (182)
  6 cd06159 S2P-M50_PDZ_Arch Uncha  99.2 3.1E-10 6.8E-15  107.5  12.1   83  189-273   107-192 (263)
  7 PF02163 Peptidase_M50:  Peptid  99.1 1.3E-10 2.8E-15  102.4   7.3  112  195-318     2-142 (192)
  8 cd06162 S2P-M50_PDZ_SREBP Ster  98.7 2.4E-08 5.2E-13   95.6   7.9   76  191-272   126-208 (277)
  9 TIGR00054 RIP metalloprotease   98.5 3.4E-07 7.4E-12   91.4   8.1   82  193-274     7-119 (420)
 10 cd06158 S2P-M50_like_1 Unchara  98.4 9.1E-07   2E-11   79.4   8.7   81  195-275     4-105 (181)
 11 PRK10779 zinc metallopeptidase  98.4 6.6E-07 1.4E-11   89.9   8.2   82  192-274     7-119 (449)
 12 COG1994 SpoIVFB Zn-dependent p  97.3  0.0012 2.7E-08   61.0   8.6   70  189-264    41-110 (230)
 13 PF13398 Peptidase_M50B:  Pepti  97.0  0.0015 3.2E-08   59.5   6.2   66  201-273    23-88  (200)
 14 COG0750 Predicted membrane-ass  96.8  0.0012 2.5E-08   63.8   3.7  119  199-319   181-320 (375)
 15 COG0750 Predicted membrane-ass  95.2   0.059 1.3E-06   52.1   7.3   80  192-274     5-120 (375)
 16 KOG2921 Intramembrane metallop  93.1    0.15 3.3E-06   51.9   5.3  121  191-316   121-268 (484)
 17 PF05572 Peptidase_M43:  Pregna  69.6     2.3 4.9E-05   37.5   1.1   16  200-215    69-84  (154)
 18 PF11667 DUF3267:  Protein of u  68.5     5.4 0.00012   32.7   3.1   72  199-277     3-74  (111)
 19 PF00413 Peptidase_M10:  Matrix  67.8     3.2 6.9E-05   34.8   1.6   20  200-219   105-124 (154)
 20 PF13688 Reprolysin_5:  Metallo  66.4     2.8 6.2E-05   36.9   1.1   22  198-219   140-161 (196)
 21 cd04279 ZnMc_MMP_like_1 Zinc-d  64.5     4.2   9E-05   34.9   1.7   22  200-221   104-125 (156)
 22 PF01435 Peptidase_M48:  Peptid  64.1     4.9 0.00011   35.5   2.2   20  200-221    89-108 (226)
 23 PF13485 Peptidase_MA_2:  Pepti  63.3     6.2 0.00013   31.0   2.4   18  201-218    26-43  (128)
 24 PF06114 DUF955:  Domain of unk  62.4     5.2 0.00011   31.2   1.8   17  202-218    44-60  (122)
 25 PF13574 Reprolysin_2:  Metallo  61.0     4.4 9.5E-05   35.9   1.3   20  200-219   111-130 (173)
 26 cd04268 ZnMc_MMP_like Zinc-dep  58.5     9.4  0.0002   32.4   2.9   25  195-219    89-113 (165)
 27 KOG2264 Exostosin EXT1L [Signa  55.4      17 0.00037   39.2   4.6  102    8-126   131-235 (907)
 28 cd04270 ZnMc_TACE_like Zinc-de  54.9     7.7 0.00017   36.4   1.9   22  197-218   164-185 (244)
 29 cd04269 ZnMc_adamalysin_II_lik  53.7       9 0.00019   33.9   2.0   21  199-219   130-150 (194)
 30 PF13582 Reprolysin_3:  Metallo  53.0     6.1 0.00013   32.1   0.8   14  202-215   109-122 (124)
 31 COG2856 Predicted Zn peptidase  50.8       8 0.00017   36.2   1.3   15  203-217    75-89  (213)
 32 cd04278 ZnMc_MMP Zinc-dependen  50.8       7 0.00015   33.6   0.8   19  200-218   107-125 (157)
 33 cd00203 ZnMc Zinc-dependent me  50.4     8.2 0.00018   32.7   1.2   21  198-218    94-114 (167)
 34 cd04267 ZnMc_ADAM_like Zinc-de  50.0     7.4 0.00016   34.3   0.9   20  200-219   133-152 (192)
 35 PF14891 Peptidase_M91:  Effect  48.4      12 0.00026   33.3   1.9   19  200-218   103-121 (174)
 36 PHA02456 zinc metallopeptidase  47.7      11 0.00024   32.7   1.5   17  204-220    83-99  (141)
 37 PRK03001 M48 family peptidase;  47.6      12 0.00026   35.7   1.9   13  200-212   124-136 (283)
 38 PF13699 DUF4157:  Domain of un  47.1      12 0.00026   29.6   1.6   13  202-214    63-75  (79)
 39 cd04277 ZnMc_serralysin_like Z  46.8      11 0.00024   33.2   1.4   19  200-218   113-131 (186)
 40 smart00235 ZnMc Zinc-dependent  46.7      10 0.00022   31.6   1.2   16  203-218    89-104 (140)
 41 PF12315 DUF3633:  Protein of u  45.8      14 0.00031   34.8   2.1   30  188-220    83-112 (212)
 42 PRK03982 heat shock protein Ht  45.0      14  0.0003   35.4   1.9   13  200-212   125-137 (288)
 43 PF12388 Peptidase_M57:  Dual-a  44.9      11 0.00024   35.4   1.3   26  193-218   126-151 (211)
 44 PF01421 Reprolysin:  Reprolysi  43.1      17 0.00038   32.2   2.2   22  198-219   129-150 (199)
 45 COG5309 Exo-beta-1,3-glucanase  42.4      44 0.00095   33.1   4.9   67   58-127   215-284 (305)
 46 PRK04897 heat shock protein Ht  42.1      16 0.00035   35.3   1.9   13  200-212   137-149 (298)
 47 PRK02870 heat shock protein Ht  41.7      14  0.0003   36.8   1.4   19  200-221   173-191 (336)
 48 PF13583 Reprolysin_4:  Metallo  41.0     8.8 0.00019   35.1  -0.1   16  204-219   141-156 (206)
 49 PF02031 Peptidase_M7:  Strepto  39.4      18  0.0004   31.8   1.6   11  203-213    80-90  (132)
 50 COG3824 Predicted Zn-dependent  39.1      14  0.0003   32.5   0.8   16  197-212   106-121 (136)
 51 PRK01345 heat shock protein Ht  38.9      19 0.00042   35.2   1.9   13  200-212   124-136 (317)
 52 COG0501 HtpX Zn-dependent prot  38.8      20 0.00043   33.4   1.9   13  200-212   157-169 (302)
 53 cd04272 ZnMc_salivary_gland_MP  37.4      21 0.00045   32.5   1.8   20  201-220   146-165 (220)
 54 smart00731 SprT SprT homologue  37.1      21 0.00046   30.7   1.7   18  199-216    58-75  (146)
 55 PF13721 SecD-TM1:  SecD export  37.0      43 0.00094   27.6   3.4   52   65-120    49-100 (101)
 56 PRK02391 heat shock protein Ht  36.9      22 0.00047   34.5   1.9   12  200-211   133-144 (296)
 57 PRK03072 heat shock protein Ht  36.6      22 0.00048   34.2   1.9   13  200-212   127-139 (288)
 58 TIGR02500 type_III_yscD type I  36.4      83  0.0018   31.8   6.0   44   83-126   302-345 (410)
 59 PRK05457 heat shock protein Ht  36.3      23 0.00049   34.2   1.9   12  200-211   134-145 (284)
 60 PF10263 SprT-like:  SprT-like   36.2      27 0.00058   29.7   2.2   18  199-216    59-76  (157)
 61 PF14247 DUF4344:  Domain of un  36.2      38 0.00082   31.9   3.3   25  196-221    88-112 (220)
 62 cd03513 CrtW_beta-carotene-ket  36.0      60  0.0013   30.4   4.6   18  202-219    47-65  (225)
 63 PRK01265 heat shock protein Ht  35.7      23  0.0005   35.1   1.9   20  200-222   140-159 (324)
 64 cd04327 ZnMc_MMP_like_3 Zinc-d  35.3      21 0.00046   32.1   1.5   15  202-216    94-108 (198)
 65 PF09585 Lin0512_fam:  Conserve  34.4      19  0.0004   30.9   0.9   59   31-93     33-91  (113)
 66 cd03512 Alkane-hydroxylase Alk  34.1      99  0.0021   30.3   6.0   16  195-210    81-96  (314)
 67 PF13796 Sensor:  Putative sens  33.9 3.2E+02   0.007   23.9   9.3   74  190-263    30-104 (181)
 68 PF09471 Peptidase_M64:  IgA Pe  33.1      25 0.00054   33.8   1.6   16  199-214   215-230 (264)
 69 PF01434 Peptidase_M41:  Peptid  32.4      32 0.00069   31.5   2.2   19  200-218    28-46  (213)
 70 KOG2719 Metalloprotease [Gener  31.8      27 0.00057   36.2   1.7   41  200-241   280-320 (428)
 71 cd04275 ZnMc_pappalysin_like Z  29.8     8.4 0.00018   36.1  -2.1   16  200-215   137-152 (225)
 72 PRK09966 putative inner membra  29.7 1.7E+02  0.0036   28.3   6.7   98   17-136   237-334 (407)
 73 cd06459 M3B_Oligoendopeptidase  29.0      32  0.0007   33.7   1.7   13  202-214   224-236 (427)
 74 TIGR00275 flavoprotein, HI0933  28.8      52  0.0011   32.7   3.1   66   30-95    283-353 (400)
 75 PF01431 Peptidase_M13:  Peptid  28.8      43 0.00093   29.8   2.3   22  193-214    29-50  (206)
 76 PF04228 Zn_peptidase:  Putativ  28.2      46 0.00099   32.6   2.5   15  201-215   171-185 (292)
 77 PF06262 DUF1025:  Possibl zinc  27.6      41 0.00089   27.8   1.8   16  197-212    70-85  (97)
 78 PF01432 Peptidase_M3:  Peptida  27.5      39 0.00084   34.0   2.0   20  201-220   243-262 (458)
 79 COG0819 TenA Putative transcri  27.2      72  0.0016   30.0   3.6   55   19-73    144-202 (218)
 80 PRK10733 hflB ATP-dependent me  27.1      66  0.0014   34.5   3.7   38  201-241   409-448 (644)
 81 TIGR02289 M3_not_pepF oligoend  26.6      38 0.00081   35.3   1.8   13  201-213   338-350 (549)
 82 COG4783 Putative Zn-dependent   26.5      38 0.00082   35.6   1.7   18  200-219   130-147 (484)
 83 PF01447 Peptidase_M4:  Thermol  25.7      45 0.00097   29.4   1.8   11  203-213   138-148 (150)
 84 PRK07650 4-amino-4-deoxychoris  25.3      79  0.0017   29.8   3.5   78   35-117   199-279 (283)
 85 cd06258 Peptidase_M3_like The   24.7      37 0.00081   32.9   1.3   13  203-215   157-169 (365)
 86 cd04271 ZnMc_ADAM_fungal Zinc-  24.5      28 0.00061   32.4   0.3   16  202-217   147-162 (228)
 87 PF04315 DUF462:  Protein of un  24.4      48   0.001   30.2   1.8   16  204-219    45-62  (164)
 88 TIGR00181 pepF oligoendopeptid  24.4      41 0.00089   35.1   1.5   12  201-212   379-390 (591)
 89 PRK04860 hypothetical protein;  23.3      78  0.0017   28.4   2.9   22  197-218    60-81  (160)
 90 PRK10629 EnvZ/OmpR regulon mod  23.3 1.3E+02  0.0029   25.9   4.2   60   62-125    50-109 (127)
 91 cd04276 ZnMc_MMP_like_2 Zinc-d  23.1      57  0.0012   30.0   2.1   19  198-216   114-132 (197)
 92 PRK10245 adrA diguanylate cycl  22.2 2.3E+02  0.0051   27.9   6.3   80   23-119   200-280 (366)
 93 TIGR03296 M6dom_TIGR03296 M6 f  22.1      21 0.00046   34.2  -1.0   12  201-212   166-177 (286)
 94 PLN02259 branched-chain-amino-  22.0      99  0.0021   31.3   3.7   73   36-112   294-372 (388)
 95 PF04155 Ground-like:  Ground-l  22.0 1.5E+02  0.0032   22.8   3.9   29   96-124    22-50  (76)
 96 cd04273 ZnMc_ADAMTS_like Zinc-  21.9      13 0.00028   33.6  -2.4   20  200-219   140-159 (207)
 97 TIGR02290 M3_fam_3 oligoendope  21.8      52  0.0011   34.5   1.7   12  202-213   377-388 (587)
 98 PF04298 Zn_peptidase_2:  Putat  21.5      58  0.0013   30.9   1.8   14  202-215    91-104 (222)
 99 PLN02782 Branched-chain amino   21.2 1.3E+02  0.0029   30.5   4.4   75   36-112   308-387 (403)
100 cd06455 M3A_TOP Peptidase M3 T  20.9      60  0.0013   33.2   1.9   25   97-121   157-181 (472)
101 PF12301 CD99L2:  CD99 antigen   20.7      70  0.0015   29.1   2.1   26  252-277   109-134 (169)
102 KOG1047 Bifunctional leukotrie  20.6      48   0.001   35.7   1.1   16  200-215   288-303 (613)
103 PF10692 DUF2498:  Protein of u  20.6 3.8E+02  0.0082   21.9   5.9   44   75-119    29-80  (82)
104 PRK13267 archaemetzincin-like   20.5      52  0.0011   29.9   1.2   16  202-217   127-142 (179)
105 KOG2661 Peptidase family M48 [  20.5      70  0.0015   32.7   2.2   18   69-86    156-173 (424)
106 PF12046 DUF3529:  Protein of u  20.4      32  0.0007   31.5  -0.1   48   60-107    42-90  (173)
107 cd04280 ZnMc_astacin_like Zinc  20.3      53  0.0012   29.3   1.2   16  202-217    76-91  (180)
108 PF14552 Tautomerase_2:  Tautom  20.0 1.1E+02  0.0023   24.4   2.8   34   92-125    39-75  (82)

No 1  
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=99.85  E-value=9.2e-21  Score=170.01  Aligned_cols=128  Identities=31%  Similarity=0.428  Sum_probs=107.8

Q ss_pred             HHHHHHHHHHHHHhhhccCCC--CchhhHHHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceee
Q 020890          162 VLCVATFGTIAIMSGLFLKPD--ATFDDYLANVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMN  239 (320)
Q Consensus       162 ~L~~~Tl~Tt~~~g~~~~~~~--~~~~~~~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~  239 (320)
                      +++++|++|....+.+..+.+  ..+. .+..+++++++++.++.+||+||+++||++|+|++.|+++|+..+|++|+++
T Consensus         2 ~~~~~s~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~l~~~l~iHElgH~~~A~~~G~~~~~~~l~P~~~~G~~G~~~   80 (183)
T cd06160           2 LLLVLTLLTTLLVGAWLSGNDVPGNPL-LLLQGLPFALALLAILGIHEMGHYLAARRHGVKASLPYFIPFPFIGTFGAFI   80 (183)
T ss_pred             HHHHHHHHHHHHHHHHHhcccccccHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCccceeeeehHhcCcEEEEE
Confidence            577889888887765543322  1122 4678999999999999999999999999999999999999998899999999


Q ss_pred             ecCCCCCCchhhhhhhhhhhHHHHHHHHHHHHHHHhhCCCCCCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhh
Q 020890          240 NYESLLPNKKALFDIPVARTASAYLTSLALAVAAFVADGSFNGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLL  318 (320)
Q Consensus       240 ~~~s~~p~r~alfdIaiAGPlag~~~al~~~~~Gl~ls~~~~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~  318 (320)
                      ++++..++|+++++|++|||++|+++++++++++                            +...+|+++.++++||+
T Consensus        81 ~~~~~~~~~~~~~~IalAGPl~nl~lali~~~~~----------------------------~~~~~~~nl~l~~fNLL  131 (183)
T cd06160          81 RMRSPIPNRKALFDIALAGPLAGLLLALPVLIIG----------------------------LAVAGWVGLLVTALNLL  131 (183)
T ss_pred             EecCCCCChhHhehhhhhHHHHHHHHHHHHHHHH----------------------------HHHHHHHHHHHHHHHhC
Confidence            9999999999999999999999999999887765                            23456777777777775


No 2  
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=99.59  E-value=2e-14  Score=132.61  Aligned_cols=111  Identities=18%  Similarity=0.072  Sum_probs=91.6

Q ss_pred             HHHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHHHHHH
Q 020890          188 YLANVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAYLTSL  267 (320)
Q Consensus       188 ~~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~~~al  267 (320)
                      .+..|+.++++++.++++||+||+++||++|+++.      .+.+..||+++++++.++++++++.|++|||++++++++
T Consensus        41 ~~~~g~~~~~~l~~~v~iHElgH~~~A~~~G~~v~------~i~l~p~Gg~~~~~~~~~~~~~~~~IalAGPl~Nllla~  114 (227)
T cd06164          41 AWLLGLAAALLLFASVLLHELGHSLVARRYGIPVR------SITLFLFGGVARLEREPETPGQEFVIAIAGPLVSLVLAL  114 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCeEC------eEEEEeeeEEEEecCCCCCHHHHhhhhhhHHHHHHHHHH
Confidence            57889999999999999999999999999999985      566777899999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCCCCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhh
Q 020890          268 ALAVAAFVADGSFNGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLL  318 (320)
Q Consensus       268 ~~~~~Gl~ls~~~~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~  318 (320)
                      +++++....+.+.              .+....-+...+|+-++....||+
T Consensus       115 i~~~l~~~~~~~~--------------~~~~~~~~~~~~~~Nl~l~~fNLl  151 (227)
T cd06164         115 LFLLLSLALPGSG--------------AGPLGVLLGYLALINLLLAVFNLL  151 (227)
T ss_pred             HHHHHHHHhcccc--------------chHHHHHHHHHHHHHHHHHHHhCc
Confidence            9888776554321              011112245567888888888987


No 3  
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=99.47  E-value=2.6e-13  Score=123.23  Aligned_cols=109  Identities=17%  Similarity=0.073  Sum_probs=90.5

Q ss_pred             HHHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHHHHHH
Q 020890          188 YLANVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAYLTSL  267 (320)
Q Consensus       188 ~~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~~~al  267 (320)
                      .|..++.+++.++.++++||+||+++||++|+++      +.+.+..||+++++++.+.+|++.+.|++|||++++++++
T Consensus        26 ~~~~~~~~~l~l~~~v~iHElgH~~~A~~~G~~v------~~i~l~p~Gg~~~~~~~~~~~~~~~lIalAGPl~n~~la~   99 (208)
T cd06161          26 AWLLGLLEALLLFLSVLLHELGHALVARRYGIRV------RSITLLPFGGVAELEEEPETPKEEFVIALAGPLVSLLLAG   99 (208)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCc------cceEEEeeeeeeeeccCCCChhHheeeeeehHHHHHHHHH
Confidence            5778999999999999999999999999999997      4677788899999998888999999999999999999999


Q ss_pred             HHHHHHHhhCCCCCCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhh
Q 020890          268 ALAVAAFVADGSFNGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLL  318 (320)
Q Consensus       268 ~~~~~Gl~ls~~~~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~  318 (320)
                      +++++....++.                ....+.+...+|+.++..+.||+
T Consensus       100 ~~~~l~~~~~~~----------------~~~~~~~~~~~~~N~~l~lfNLl  134 (208)
T cd06161         100 LFYLLYLLLPGG----------------GPLSSLLEFLAQVNLILGLFNLL  134 (208)
T ss_pred             HHHHHHHHcccc----------------hHHHHHHHHHHHHHHHHHHHHcc
Confidence            887766544321                11233455667888888888886


No 4  
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=99.35  E-value=4.1e-12  Score=111.38  Aligned_cols=114  Identities=18%  Similarity=0.126  Sum_probs=84.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhCccc-----------------ccccccccccccccceeeecCCCCCC-----chhh
Q 020890          194 PLFGGLITILGVSEISTRLTAARYGVKL-----------------SPSFLVPSNWTGCLGVMNNYESLLPN-----KKAL  251 (320)
Q Consensus       194 p~al~ll~iL~~HElGH~~~Ar~~gv~~-----------------slPyFIP~~~lGtfGav~~~~s~~p~-----r~al  251 (320)
                      .+.++++.++.+||+||+++||++|+++                 ...+++|.      |++.++.+..++     |++.
T Consensus         2 ~~~~~~~i~i~iHE~gH~~~A~~~G~~~~~~~~~~~~~~~~~~~~~~~~~ip~------gG~~~~~~~~~~~~~~~~~~~   75 (180)
T cd05709           2 AFILALLISVTVHELGHALVARRLGVKVARFSGGFTLNPLKHGDPYGIILIPL------GGYAKPVGENPRAFKKPRWQR   75 (180)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHcCCCchheeeeEEECCcCCCCEehHHHHhc------cCeeccCCCChhhhccchhhh
Confidence            4678889999999999999999999954                 33444444      999999887765     8899


Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHhhCCCCCCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhhc
Q 020890          252 FDIPVARTASAYLTSLALAVAAFVADGSFNGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLLV  319 (320)
Q Consensus       252 fdIaiAGPlag~~~al~~~~~Gl~ls~~~~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~~  319 (320)
                      +.|++|||+++++++++++.+....+.......     . ........+.+.+.+|+.+...++||+-
T Consensus        76 ~~i~laGPl~nllla~i~~~~~~~~~~~~~~~~-----~-~~~~~~~~~~l~~~~~~n~~l~~fNLlP  137 (180)
T cd05709          76 LLVALAGPLANLLLALLLLLLLLLLGGLPPAPV-----G-QAASSGLANLLAFLALINLNLAVFNLLP  137 (180)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHccCCccch-----h-hhHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            999999999999999999877765553211000     0 0011234556788899999999999873


No 5  
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=99.16  E-value=1.7e-10  Score=103.84  Aligned_cols=78  Identities=22%  Similarity=0.160  Sum_probs=58.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhCccccccccc---cc------------ccccccceeeecCCCCC------------
Q 020890          194 PLFGGLITILGVSEISTRLTAARYGVKLSPSFLV---PS------------NWTGCLGVMNNYESLLP------------  246 (320)
Q Consensus       194 p~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFI---P~------------~~lGtfGav~~~~s~~p------------  246 (320)
                      .+.+++..++.+||+||+++||++|+++.- |.|   |.            +.+-.+|++.++++..+            
T Consensus         3 ~~~i~l~~~v~iHElGH~~~Ar~~Gv~v~~-f~iGfGp~l~~~~~~~t~~~i~~iPlGGyv~~~~~~~~~~~~~~~~~~~   81 (182)
T cd06163           3 AFILVLGILIFVHELGHFLVAKLFGVKVEE-FSIGFGPKLFSFKKGETEYSISAIPLGGYVKMLGEDPEEEADPEDDPRS   81 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHcCCeeeE-eeeecCceeeeeecCCeEEEEEEEEeccEEEecCCCcccccccccchHH
Confidence            466788899999999999999999999752 111   10            11334799999886433            


Q ss_pred             ----CchhhhhhhhhhhHHHHHHHHHHHHH
Q 020890          247 ----NKKALFDIPVARTASAYLTSLALAVA  272 (320)
Q Consensus       247 ----~r~alfdIaiAGPlag~~~al~~~~~  272 (320)
                          ++++.+-|++|||+++++++++++.+
T Consensus        82 f~~~~~~~ri~V~lAGP~~NlilA~i~~~~  111 (182)
T cd06163          82 FNSKPVWQRILIVFAGPLANFLLAIVLFAV  111 (182)
T ss_pred             HccCCcchhhhhhhhHHHHHHHHHHHHHHH
Confidence                35677889999999999999887654


No 6  
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=99.15  E-value=3.1e-10  Score=107.45  Aligned_cols=83  Identities=14%  Similarity=0.071  Sum_probs=65.6

Q ss_pred             HHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCC---CCchhhhhhhhhhhHHHHHH
Q 020890          189 LANVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLL---PNKKALFDIPVARTASAYLT  265 (320)
Q Consensus       189 ~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~---p~r~alfdIaiAGPlag~~~  265 (320)
                      +...+.+.++++.++.+||+||+++||++|+++..--+.  ..+-.+||+.++.+..   .++++.+.|+.|||++++++
T Consensus       107 ~i~~~~~~iaL~isv~iHElgHa~~Ar~~G~~V~~iGl~--l~~ip~Gg~v~~~~~~~~~~~~~~~~~Ia~AGP~~Nlvl  184 (263)
T cd06159         107 FIPLPYGIIALVVGVVVHELSHGILARVEGIKVKSGGLL--LLIIPPGAFVEPDEEELNKADRRIRLRIFAAGVTANFVV  184 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCEECchhHH--HHhhhcEEEEEecchhhccCChhheeeeeeehHHHHHHH
Confidence            456777888999999999999999999999998631110  1112378999987765   56788999999999999999


Q ss_pred             HHHHHHHH
Q 020890          266 SLALAVAA  273 (320)
Q Consensus       266 al~~~~~G  273 (320)
                      +++++++-
T Consensus       185 a~i~~~l~  192 (263)
T cd06159         185 ALIAFALF  192 (263)
T ss_pred             HHHHHHHH
Confidence            98887653


No 7  
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=99.12  E-value=1.3e-10  Score=102.42  Aligned_cols=112  Identities=15%  Similarity=0.108  Sum_probs=67.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCcccccccccc--ccc---------------c-------c-----ccceeeecCCCC
Q 020890          195 LFGGLITILGVSEISTRLTAARYGVKLSPSFLVP--SNW---------------T-------G-----CLGVMNNYESLL  245 (320)
Q Consensus       195 ~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP--~~~---------------l-------G-----tfGav~~~~s~~  245 (320)
                      +.++++.++.+||+||.++|+++|.++.-...-+  .+.               +       |     ..++..+.+...
T Consensus         2 ~~~~~~i~i~~HE~gH~~~a~~~G~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~g~~~~~G~~~~~~~~~~~~~~~~~   81 (192)
T PF02163_consen    2 FILALLISIVLHELGHALAARLYGDKVPRFEGGFGLNIFSHRDGFTIWSIRLIPLGGYVGGFGWSNVNPFPAPISESFRK   81 (192)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHTTT--B--EEE------------------------------------------------
T ss_pred             CcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCC
Confidence            4678899999999999999999999986552111  100               0       1     133455555567


Q ss_pred             CCchhhhhhhhhhhHHHHHHHHHHHHHHHhhCCCCCCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhh
Q 020890          246 PNKKALFDIPVARTASAYLTSLALAVAAFVADGSFNGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLL  318 (320)
Q Consensus       246 p~r~alfdIaiAGPlag~~~al~~~~~Gl~ls~~~~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~  318 (320)
                      .+|+..+.+++|||+++++++++++.+....+....            ......+.+.+.+|+.+...++||+
T Consensus        82 ~~~~~~~~i~laGp~~nllla~i~~~l~~~~~~~~~------------~~~~~~~~~~~~~~~n~~l~~~Nll  142 (192)
T PF02163_consen   82 RSRWKRILIALAGPLANLLLAIIALLLLYLLSGSVG------------WSSFFAEFLFFFAWLNFILALFNLL  142 (192)
T ss_dssp             --TTCHHHHHHHHHHHHHHHHHHHHHHTTS-------------------EETTEEHHHHHHHHHHHHHHHTTS
T ss_pred             CCccceEEEEEEcHHHHHHHHHHHHHHHHHHhcccc------------ccHHHHHHHHHHHHHHHHHhhhhcc
Confidence            778889999999999999999888776654443111            2235677888899999999999986


No 8  
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=98.74  E-value=2.4e-08  Score=95.55  Aligned_cols=76  Identities=16%  Similarity=0.058  Sum_probs=60.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHhCccccccccccccccccc----ceeeecCCC---CCCchhhhhhhhhhhHHHH
Q 020890          191 NVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCL----GVMNNYESL---LPNKKALFDIPVARTASAY  263 (320)
Q Consensus       191 ~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtf----Gav~~~~s~---~p~r~alfdIaiAGPlag~  263 (320)
                      ....+.++++.++.+||+||.++|+++|+++.      .+.+..|    ||+.+..+.   ..++++.+-|+.|||++++
T Consensus       126 ~~~~~l~al~isvvvHElgHal~A~~~gi~V~------~iGl~l~~~~pGa~ve~~~e~~~~~~~~~~l~Ia~AGp~~Nl  199 (277)
T cd06162         126 QLGYYFTALLISGVVHEMGHGVAAVREQVRVN------GFGIFFFIIYPGAYVDLFTDHLNLISPVQQLRIFCAGVWHNF  199 (277)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHcCCeec------eEEEeeeeccCeeEEeecccccccCChhhhhheehhhHHHHH
Confidence            44445678899999999999999999999986      4333334    999998543   3566778999999999999


Q ss_pred             HHHHHHHHH
Q 020890          264 LTSLALAVA  272 (320)
Q Consensus       264 ~~al~~~~~  272 (320)
                      +++++++++
T Consensus       200 vLa~i~~~l  208 (277)
T cd06162         200 VLGLVGYLL  208 (277)
T ss_pred             HHHHHHHHH
Confidence            999887653


No 9  
>TIGR00054 RIP metalloprotease RseP. A model that detects fragments as well matches a number of members of the PEPTIDASE FAMILY S2C. The region of match appears not to overlap the active site domain.
Probab=98.48  E-value=3.4e-07  Score=91.35  Aligned_cols=82  Identities=17%  Similarity=0.090  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhCcccc-------cccccc-------cccccccceeeecCCC--------C-----
Q 020890          193 VPLFGGLITILGVSEISTRLTAARYGVKLS-------PSFLVP-------SNWTGCLGVMNNYESL--------L-----  245 (320)
Q Consensus       193 lp~al~ll~iL~~HElGH~~~Ar~~gv~~s-------lPyFIP-------~~~lGtfGav~~~~s~--------~-----  245 (320)
                      +.+.+.+..++++||+|||++||++|+++.       +|.|==       .+-+--+|++.+|...        +     
T Consensus         7 i~~~~~~~~~v~~HE~gH~~~a~~~g~~v~~FsiGfGp~l~~~~~~~tey~i~~~plGg~v~~~g~~~~~~~~~~~~~~~   86 (420)
T TIGR00054         7 LASILALAVLIFVHELGHFLAARLCGIKVERFSIGFGPKILKFKKNGTEYAISLIPLGGYVKMKGLDKEMEVKPPETDGD   86 (420)
T ss_pred             HHHHHHHHHHHHHHhHHHHHHHHHcCCEEEEEEEccCchheEEecCCeEEEEEEecCcceEeeccCCcccccCCcchhhh
Confidence            334677788999999999999999999975       111100       0113446999999411        1     


Q ss_pred             ----CCchhhhhhhhhhhHHHHHHHHHHHHHHH
Q 020890          246 ----PNKKALFDIPVARTASAYLTSLALAVAAF  274 (320)
Q Consensus       246 ----p~r~alfdIaiAGPlag~~~al~~~~~Gl  274 (320)
                          .++...+-|.+|||++.++++++++.+-+
T Consensus        87 ~f~~~~~~~r~~i~~aGp~~N~~~a~~~~~~~~  119 (420)
T TIGR00054        87 LFNNKSVFQKAIIIFAGPLANFIFAIFVYIFIS  119 (420)
T ss_pred             hhccCCHHHHHHhhhcccHHHHHHHHHHHHHHH
Confidence                24455677999999999999998877544


No 10 
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.
Probab=98.43  E-value=9.1e-07  Score=79.35  Aligned_cols=81  Identities=16%  Similarity=0.160  Sum_probs=53.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCccccc----cccccc---ccccc---------cceeee-c----CCCCCCchhhhh
Q 020890          195 LFGGLITILGVSEISTRLTAARYGVKLSP----SFLVPS---NWTGC---------LGVMNN-Y----ESLLPNKKALFD  253 (320)
Q Consensus       195 ~al~ll~iL~~HElGH~~~Ar~~gv~~sl----PyFIP~---~~lGt---------fGav~~-~----~s~~p~r~alfd  253 (320)
                      ..++++.++..||+||.++|+++|-++.-    -.+=|.   -.+|+         .++..+ .    +...++|++.+-
T Consensus         4 ~~~~~~~~i~~HE~aHa~~A~~~Gd~t~~~~Grltlnp~~hid~~g~l~~~~~~~~~~G~a~p~~~~~~~~~~~r~~~~~   83 (181)
T cd06158           4 VIIAVLLAITLHEFAHAYVAYRLGDPTARRAGRLTLNPLAHIDPIGTIILPLLLPFLFGWAKPVPVNPRNFKNPRRGMLL   83 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHcCCcHHHHcCceecCcHHhcCcchHHHHHHHHHhCeEEecccccChHhhcccHhhHhh
Confidence            45678889999999999999999998631    111121   00110         133322 1    112245678999


Q ss_pred             hhhhhhHHHHHHHHHHHHHHHh
Q 020890          254 IPVARTASAYLTSLALAVAAFV  275 (320)
Q Consensus       254 IaiAGPlag~~~al~~~~~Gl~  275 (320)
                      |++|||+++++++++++++...
T Consensus        84 valAGP~~n~~la~i~~~~~~~  105 (181)
T cd06158          84 VSLAGPLSNLLLALLFALLLRL  105 (181)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHH
Confidence            9999999999999887655443


No 11 
>PRK10779 zinc metallopeptidase RseP; Provisional
Probab=98.41  E-value=6.6e-07  Score=89.85  Aligned_cols=82  Identities=16%  Similarity=0.075  Sum_probs=57.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhCccccccccccc----------------ccccccceeeecCCCCC---------
Q 020890          192 VVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPS----------------NWTGCLGVMNNYESLLP---------  246 (320)
Q Consensus       192 glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~----------------~~lGtfGav~~~~s~~p---------  246 (320)
                      -+.+.+++..++.+||+|||++||..||++.- |.|-+                +-+--+|++.+|...-+         
T Consensus         7 i~~fil~l~~li~vHElGHfl~Ar~~gv~V~~-FsiGfGp~l~~~~~~~~Tey~i~~iPlGGyVk~~~e~~~~~~~~~~~   85 (449)
T PRK10779          7 LAAFIVALGVLITVHEFGHFWVARRCGVRVER-FSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEPVAPELRH   85 (449)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCCeeeE-EEeecChhHeeEecCCCcEEEEEEEcCCCeeecCCCCCCcCChhhhh
Confidence            44566777788899999999999999999862 11111                11223688888865421         


Q ss_pred             ------CchhhhhhhhhhhHHHHHHHHHHHHHHH
Q 020890          247 ------NKKALFDIPVARTASAYLTSLALAVAAF  274 (320)
Q Consensus       247 ------~r~alfdIaiAGPlag~~~al~~~~~Gl  274 (320)
                            ++.+-+-|.+|||++.+++|++++.+-+
T Consensus        86 ~~f~~k~~~~R~~i~~AGp~~N~ila~~~~~~~~  119 (449)
T PRK10779         86 HAFNNKTVGQRAAIIAAGPIANFIFAIFAYWLVF  119 (449)
T ss_pred             hhhccCCHHHhhhhhhhhHHHHHHHHHHHHHHHH
Confidence                  1223455999999999999988765544


No 12 
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only]
Probab=97.27  E-value=0.0012  Score=61.02  Aligned_cols=70  Identities=21%  Similarity=0.180  Sum_probs=58.8

Q ss_pred             HHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHHH
Q 020890          189 LANVVPLFGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAYL  264 (320)
Q Consensus       189 ~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~~  264 (320)
                      +.++....++++..+..||+||+..++++++++.      .+.++.+|++..++..+.+++..++++.+||+++..
T Consensus        41 ~~~~~~~~~~l~~rl~l~~~gh~~~~~~~~~~l~------~~~i~~~~g~~~~~~~~v~~~~~~~~~~~g~lvs~a  110 (230)
T COG1994          41 LGDGTAAFVGLAHRLVLHPLGHSDEAGRLGLKLL------LALLFGFGGFGFLKPVPVNPRGEFLIRLAGPLVSLA  110 (230)
T ss_pred             HhhhHHHHHHHhHHHhhhHhhHHHHHHHHHHHHH------HHHHHhccceeeecCcCcCHHHHhhhhccchhHHHH
Confidence            6667777777889999999999999999999873      544545888999999999999999988777766665


No 13 
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=97.01  E-value=0.0015  Score=59.49  Aligned_cols=66  Identities=21%  Similarity=0.136  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHHHHHHHHHHHH
Q 020890          201 TILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAYLTSLALAVAA  273 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~~~al~~~~~G  273 (320)
                      ....+||+||.++|.-.|-+++--..-|.     -++.+..+.  +++-..+-++.|||++..+.+..++..+
T Consensus        23 l~t~~HE~gHal~a~l~G~~v~~i~l~~~-----~~G~~~~~~--~~~~~~~~i~~aGyl~~~l~g~~~~~~~   88 (200)
T PF13398_consen   23 LVTFVHELGHALAALLTGGRVKGIVLFPD-----GSGVTVSSG--PSGIGRFLIALAGYLGPALFGLLLLWLL   88 (200)
T ss_pred             HHHHHHHHHHHHHHHHhCCCcceEEEEeC-----CCceEEEec--CCCcchhHHhcccchHHHHHHHHHHHHH
Confidence            34889999999999999998863333343     577887777  6666678899999999999987776666


No 14 
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]
Probab=96.77  E-value=0.0012  Score=63.83  Aligned_cols=119  Identities=15%  Similarity=0.006  Sum_probs=88.7

Q ss_pred             HHHHHHHH--HHHHHHHHHHhCcccccccccccccccccceeee--cCCCCCC-----chhhhhhhhhhhHHHHHHHHHH
Q 020890          199 LITILGVS--EISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNN--YESLLPN-----KKALFDIPVARTASAYLTSLAL  269 (320)
Q Consensus       199 ll~iL~~H--ElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~--~~s~~p~-----r~alfdIaiAGPlag~~~al~~  269 (320)
                      .+.+.+.|  +..|+.+++.++..-..|+++| ...|..++.++  ..+..|+     ++.++++..+++++ ..+.-..
T Consensus       181 ~~~i~~~~~~~~~~~~~~~~~~~~~~~P~~~~-~~~~~~~~~i~~~~i~~~p~~~~~~~~~~~~~~~~~~i~-~~v~~~~  258 (375)
T COG0750         181 LLTILVIRLDGEAHAVAAEIIKSLGLTPVVIP-LKPGDKIVAVDVGAIGLSPNGEPDVGKVLVKYGPLEAVG-LAVEKTG  258 (375)
T ss_pred             ceEEEEEeccceeeeccccceeeEeeecceec-cCCCCEEEEeeeeeeeeccCCCCccceeeeccCHHHHHH-HHHHHHH
Confidence            57888899  9999999999999999999998 77888888775  6667777     89999999999998 4455455


Q ss_pred             HHHHHhhCC-----------CC-CCCchhHHhHHhhhcccchhHHHHHHHHHHHHHHHhhhc
Q 020890          270 AVAAFVADG-----------SF-NGGDNALMLLDLIRMTLEMYCLMLWKESEFLVIRLLLLV  319 (320)
Q Consensus       270 ~~~Gl~ls~-----------~~-~gg~~~l~lg~~l~~g~~~~Pl~~~gWvGl~vt~l~l~~  319 (320)
                      .++++.++.           +. .|..+....+.........||+.+.+|+++.++++||+-
T Consensus       259 ~~~~~~~~~l~~~~~~~~~~~~l~Gpi~i~~~~~~~~~~~~~~~l~~~~~lsi~lg~lNllP  320 (375)
T COG0750         259 RLVKLTLKMLKKLITGDLSLKNLSGPIGIAKIAGAAASLGLINLLFFLALLSINLGILNLLP  320 (375)
T ss_pred             HHHHHHHHHHHHheecccccccccCceehhhhhhHHHhhHHHHHHHHHHHHHHHHHHHhccC
Confidence            555554441           11 122222333332223568999999999999999999973


No 15 
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]
Probab=95.21  E-value=0.059  Score=52.07  Aligned_cols=80  Identities=19%  Similarity=0.225  Sum_probs=51.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhCccccc------------------ccccccccccccceeeecCCCCCC------
Q 020890          192 VVPLFGGLITILGVSEISTRLTAARYGVKLSP------------------SFLVPSNWTGCLGVMNNYESLLPN------  247 (320)
Q Consensus       192 glp~al~ll~iL~~HElGH~~~Ar~~gv~~sl------------------PyFIP~~~lGtfGav~~~~s~~p~------  247 (320)
                      -..+.+.+......||+||+|.||+.++++..                  +|.+..+   .+|++.+|......      
T Consensus         5 ~i~~i~~~~~lv~~he~gh~~~a~~~~~~v~~f~ig~g~~l~~~~~~~~~~~~i~~~---plggyv~~~~~~~~~~~~~~   81 (375)
T COG0750           5 IIAFIIALGVLVFVHELGHFWVARRCGVKVERFSIGFGPKLFSRKDKGGTEYVLSAI---PLGGYVKMLGEDAEEVVLKG   81 (375)
T ss_pred             HHHHHHHHHHHHHHHHHhhHHHHHhcCceeEEEEeccCcceEEEEcCCceEEEEeec---CccceEEEecCccccccccc
Confidence            34566777788999999999999999998752                  1222222   23444444333222      


Q ss_pred             ---chh---------hhhhhhhhhHHHHHHHHHHHHHHH
Q 020890          248 ---KKA---------LFDIPVARTASAYLTSLALAVAAF  274 (320)
Q Consensus       248 ---r~a---------lfdIaiAGPlag~~~al~~~~~Gl  274 (320)
                         +..         -+-+-++||+..++.++.+.+...
T Consensus        82 ~~~~~~~f~~~~~~~~~~~~~~Gp~~n~i~~~~~~~~~~  120 (375)
T COG0750          82 PEPRPRAFNAKSVWQRIAIVFAGPLFNFILAIVLFVVLF  120 (375)
T ss_pred             cCcchhhhhcccccchhheeechHHHHHHHHHHHHHhhh
Confidence               112         234778999999998777665554


No 16 
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones]
Probab=93.08  E-value=0.15  Score=51.87  Aligned_cols=121  Identities=19%  Similarity=0.149  Sum_probs=71.1

Q ss_pred             hhHHH-HHHHHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCC----CCCchhhhhhhhhhhHHHHHH
Q 020890          191 NVVPL-FGGLITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESL----LPNKKALFDIPVARTASAYLT  265 (320)
Q Consensus       191 ~glp~-al~ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~----~p~r~alfdIaiAGPlag~~~  265 (320)
                      .+++| ...++..+.+|||||.|+|.+.||++.  +|==.+..=.=||++.++..    .++=++ ..|--||-.=.++.
T Consensus       121 ~~I~yf~t~lvi~~vvHElGHalAA~segV~vn--gfgIfi~aiyPgafvdl~~dhLqsl~~fr~-LrIfcAGIWHNfvf  197 (484)
T KOG2921|consen  121 SGIAYFLTSLVITVVVHELGHALAAASEGVQVN--GFGIFIAAIYPGAFVDLDNDHLQSLPSFRA-LRIFCAGIWHNFVF  197 (484)
T ss_pred             ccchhhhhhHHHHHHHHHhhHHHHHHhcCceee--eeEEEEEEEcCchhhhhhhhHHhhcchHHH-HHHHhhhHHHHHHH
Confidence            44444 456677889999999999999999875  11000111223677766542    223233 56888999999999


Q ss_pred             HHHHHHH----HHhhCCCCCCC----------------chhHHhHHhhhc--ccchhHHHHHHHHHHHHHHHh
Q 020890          266 SLALAVA----AFVADGSFNGG----------------DNALMLLDLIRM--TLEMYCLMLWKESEFLVIRLL  316 (320)
Q Consensus       266 al~~~~~----Gl~ls~~~~gg----------------~~~l~lg~~l~~--g~~~~Pl~~~gWvGl~vt~l~  316 (320)
                      |+.|.+.    +..+||-+.-|                .-.+..||++..  |-.+|-+  .-|...+-|.+|
T Consensus       198 allc~lal~~lpViLsPfya~g~gV~Vtev~~~Spl~gprGL~vgdvitsldgcpV~~v--~dW~ecl~tsl~  268 (484)
T KOG2921|consen  198 ALLCVLALFLLPVILSPFYAHGEGVTVTEVPSVSPLFGPRGLSVGDVITSLDGCPVHKV--SDWLECLATSLD  268 (484)
T ss_pred             HHHHHHHHHhhhHhhchhhhcCceEEEEeccccCCCcCcccCCccceEEecCCcccCCH--HHHHHHHHhhcc
Confidence            9877543    44555522111                113345666553  4444443  456666666554


No 17 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=69.55  E-value=2.3  Score=37.50  Aligned_cols=16  Identities=13%  Similarity=-0.068  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRLTAA  215 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar  215 (320)
                      .+-.++||+|||+--+
T Consensus        69 ~g~TltHEvGH~LGL~   84 (154)
T PF05572_consen   69 FGKTLTHEVGHWLGLY   84 (154)
T ss_dssp             SSHHHHHHHHHHTT--
T ss_pred             cccchhhhhhhhhccc
Confidence            3578899999997443


No 18 
>PF11667 DUF3267:  Protein of unknown function (DUF3267);  InterPro: IPR021683  This family of proteins has no known function. 
Probab=68.51  E-value=5.4  Score=32.72  Aligned_cols=72  Identities=17%  Similarity=0.105  Sum_probs=40.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHHHHHHHHHHHHHhhC
Q 020890          199 LITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAYLTSLALAVAAFVAD  277 (320)
Q Consensus       199 ll~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~~~al~~~~~Gl~ls  277 (320)
                      ++..+.+||+-|.+..+.+|-+-..    ....-...+..-...+.+=+|+. |-+...-|.  ++++++.+++++..+
T Consensus         3 ~~~~~~~HEliH~l~~~~~~~~~~~----~~g~~~~~~~~~~~~~~~~sk~~-~~i~~l~P~--ivl~~~~~~~~~~~p   74 (111)
T PF11667_consen    3 LIVLIPLHELIHGLFFKLFGKKPKV----KFGFKWKLGPFYATCNEPISKWR-FIIILLAPF--IVLTILPLILGFFFP   74 (111)
T ss_pred             EEeeHHHHHHHHHHHHHHhCCCCce----EEEEEeeeEEEEEecCcEEeHHH-HHHHHHHHH--HHHHHHHHHHHHHHH
Confidence            3456789999999999999985321    11111122333323444445444 666666675  455555555555533


No 19 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=67.82  E-value=3.2  Score=34.81  Aligned_cols=20  Identities=15%  Similarity=0.184  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHhCc
Q 020890          200 ITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv  219 (320)
                      +...+.||+||.+--.+..-
T Consensus       105 ~~~v~~HEiGHaLGL~H~~~  124 (154)
T PF00413_consen  105 LQSVAIHEIGHALGLDHSND  124 (154)
T ss_dssp             HHHHHHHHHHHHTTBESSSS
T ss_pred             hhhhhhhccccccCcCcCCC
Confidence            45678999999986644433


No 20 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=66.45  E-value=2.8  Score=36.87  Aligned_cols=22  Identities=27%  Similarity=0.027  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHhCc
Q 020890          198 GLITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       198 ~ll~iL~~HElGH~~~Ar~~gv  219 (320)
                      ..-.+.++||+||.+-|.+=+-
T Consensus       140 ~~~~~~~AHEiGH~lGa~HD~~  161 (196)
T PF13688_consen  140 YNGAITFAHEIGHNLGAPHDGD  161 (196)
T ss_dssp             HHHHHHHHHHHHHHTT-----S
T ss_pred             CceehhhHHhHHHhcCCCCCCC
Confidence            3456789999999999987554


No 21 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=64.47  E-value=4.2  Score=34.89  Aligned_cols=22  Identities=9%  Similarity=0.111  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHhCccc
Q 020890          200 ITILGVSEISTRLTAARYGVKL  221 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv~~  221 (320)
                      +...++||+||.+-.++..-+-
T Consensus       104 ~~~~~~HEiGHaLGL~H~~~~~  125 (156)
T cd04279         104 LQAIALHELGHALGLWHHSDRP  125 (156)
T ss_pred             HHHHHHHHhhhhhcCCCCCCCc
Confidence            5678899999999988887753


No 22 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=64.10  E-value=4.9  Score=35.54  Aligned_cols=20  Identities=15%  Similarity=0.036  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHhCccc
Q 020890          200 ITILGVSEISTRLTAARYGVKL  221 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv~~  221 (320)
                      +..+++||+||+.  .+|..+.
T Consensus        89 l~aVlaHElgH~~--~~h~~~~  108 (226)
T PF01435_consen   89 LAAVLAHELGHIK--HRHILKS  108 (226)
T ss_dssp             HHHHHHHHHHHHH--TTHCCCC
T ss_pred             HHHHHHHHHHHHH--cCCcchH
Confidence            5678899999986  4555443


No 23 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=63.29  E-value=6.2  Score=31.02  Aligned_cols=18  Identities=11%  Similarity=0.202  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHhC
Q 020890          201 TILGVSEISTRLTAARYG  218 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar~~g  218 (320)
                      .-+++||++|.|.....+
T Consensus        26 ~~~l~HE~~H~~~~~~~~   43 (128)
T PF13485_consen   26 DRVLAHELAHQWFGNYFG   43 (128)
T ss_pred             HHHHHHHHHHHHHHHHcC
Confidence            367899999999998865


No 24 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=62.44  E-value=5.2  Score=31.20  Aligned_cols=17  Identities=12%  Similarity=-0.080  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHhC
Q 020890          202 ILGVSEISTRLTAARYG  218 (320)
Q Consensus       202 iL~~HElGH~~~Ar~~g  218 (320)
                      ..++||+||++.-....
T Consensus        44 f~laHELgH~~~~~~~~   60 (122)
T PF06114_consen   44 FTLAHELGHILLHHGDE   60 (122)
T ss_dssp             HHHHHHHHHHHHHH-HH
T ss_pred             HHHHHHHHHHHhhhccc
Confidence            36789999999876654


No 25 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=61.02  E-value=4.4  Score=35.92  Aligned_cols=20  Identities=15%  Similarity=-0.200  Sum_probs=13.3

Q ss_pred             HHHHHHHHHHHHHHHHHhCc
Q 020890          200 ITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv  219 (320)
                      -...++||+||.+-|.+-+=
T Consensus       111 ~~~~~aHElGH~lGa~Hd~~  130 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHDFD  130 (173)
T ss_dssp             HHHHHHHHHHHHHT---SSS
T ss_pred             eeeeehhhhHhhcCCCCCCC
Confidence            44559999999999987554


No 26 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=58.54  E-value=9.4  Score=32.41  Aligned_cols=25  Identities=12%  Similarity=0.004  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCc
Q 020890          195 LFGGLITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       195 ~al~ll~iL~~HElGH~~~Ar~~gv  219 (320)
                      +......-..+||+||.+--++-.-
T Consensus        89 ~~~~~~~~~~~HEiGHaLGL~H~~~  113 (165)
T cd04268          89 YSGARLRNTAEHELGHALGLRHNFA  113 (165)
T ss_pred             HHHHHHHHHHHHHHHHHhcccccCc
Confidence            3445567888999999987665543


No 27 
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms]
Probab=55.43  E-value=17  Score=39.20  Aligned_cols=102  Identities=26%  Similarity=0.346  Sum_probs=66.7

Q ss_pred             HHHHhhhhhhhhhhhhhcccCCCCchhhhhhhhhccchHHHHhhhhhhhhccCHhhHHHhhcccCcceEEEee---eeEe
Q 020890            8 AAIKLEKKRADTKLKELDRESTDNPIMRLFNRLVRDSLTREKERLEKAEESFKALDLNKLRGCFGFDTFFATD---VRRF   84 (320)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF~vte---~~~~   84 (320)
                      .|+|-|-..|++.+||+-.  ++||-..+=-++.-..+|||++.++.+..-       ++-+||.++.--+|+   +--|
T Consensus       131 ~~Lk~~ieqaq~~~~El~~--~n~pkl~LP~sllP~~~pr~l~pp~~~~~c-------~lhncfdySRCsltSgfPVYvy  201 (907)
T KOG2264|consen  131 SALKGEIEQAQRQLEELRE--TNNPKLFLPFSLLPLQIPRELEPPSQISPC-------QLHNCFDYSRCSLTSGFPVYVY  201 (907)
T ss_pred             HHHHhHHHHHHHHHHHHHh--hcCCceeeccccCcccCcccCCCccccCcc-------cchhccccccccccCCceeEEe
Confidence            3667777778888888754  456766666677788888999998877555       788999998877776   2223


Q ss_pred             CCeEEEEccCCCcHHHHHHHHHHHHHHHhCCCeEEEEEeecC
Q 020890           85 GDGGIFIGNLRKPIEEVIPKLEKKLSEAAGRDVVVWFMEEKT  126 (320)
Q Consensus        85 ~~gvi~rGnLR~~~e~v~~~L~~~L~~~fgd~y~l~l~e~~~  126 (320)
                      +.-.+..|.   +.++   -++.-+++..  +|.+.++|+++
T Consensus       202 d~D~~~~G~---~~d~---~lk~~fq~t~--~~n~~~ve~pd  235 (907)
T KOG2264|consen  202 DSDIITSGQ---SEDE---WLKQVFQETI--PNNVYLVETPD  235 (907)
T ss_pred             ccceeeccc---chHH---HHHHHHHHhc--ccceeEeeCCC
Confidence            333333354   2222   2333444443  67788888864


No 28 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=54.88  E-value=7.7  Score=36.35  Aligned_cols=22  Identities=5%  Similarity=0.031  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhC
Q 020890          197 GGLITILGVSEISTRLTAARYG  218 (320)
Q Consensus       197 l~ll~iL~~HElGH~~~Ar~~g  218 (320)
                      ....++.++|||||-+-+.+-+
T Consensus       164 ~~~~a~t~AHElGHnlGm~HD~  185 (244)
T cd04270         164 TKESDLVTAHELGHNFGSPHDP  185 (244)
T ss_pred             hhHHHHHHHHHHHHhcCCCCCC
Confidence            4457789999999999887544


No 29 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=53.70  E-value=9  Score=33.88  Aligned_cols=21  Identities=14%  Similarity=0.120  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhCc
Q 020890          199 LITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       199 ll~iL~~HElGH~~~Ar~~gv  219 (320)
                      ..+..++||+||.+-+.+-+-
T Consensus       130 ~~a~~~AHElGH~lG~~HD~~  150 (194)
T cd04269         130 LFAVTMAHELGHNLGMEHDDG  150 (194)
T ss_pred             HHHHHHHHHHHhhcCCCcCCC
Confidence            346889999999998876554


No 30 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=53.02  E-value=6.1  Score=32.10  Aligned_cols=14  Identities=21%  Similarity=-0.021  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLTAA  215 (320)
Q Consensus       202 iL~~HElGH~~~Ar  215 (320)
                      ..++||+||-+-++
T Consensus       109 ~~~~HEiGH~lGl~  122 (124)
T PF13582_consen  109 DTFAHEIGHNLGLN  122 (124)
T ss_dssp             THHHHHHHHHTT--
T ss_pred             eEeeehhhHhcCCC
Confidence            67899999987554


No 31 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=50.83  E-value=8  Score=36.18  Aligned_cols=15  Identities=13%  Similarity=0.053  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHh
Q 020890          203 LGVSEISTRLTAARY  217 (320)
Q Consensus       203 L~~HElGH~~~Ar~~  217 (320)
                      .++||+||++.=++-
T Consensus        75 tlAHELGH~llH~~~   89 (213)
T COG2856          75 TLAHELGHALLHTDL   89 (213)
T ss_pred             HHHHHHhHHHhcccc
Confidence            468999999976554


No 32 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=50.79  E-value=7  Score=33.59  Aligned_cols=19  Identities=16%  Similarity=0.167  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHhC
Q 020890          200 ITILGVSEISTRLTAARYG  218 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~g  218 (320)
                      +...+.||+||.+--.+-.
T Consensus       107 ~~~~~~HEiGHaLGL~H~~  125 (157)
T cd04278         107 LFSVAAHEIGHALGLGHSS  125 (157)
T ss_pred             HHHHHHHHhccccccCCCC
Confidence            5667899999998775443


No 33 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=50.40  E-value=8.2  Score=32.67  Aligned_cols=21  Identities=10%  Similarity=-0.233  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhC
Q 020890          198 GLITILGVSEISTRLTAARYG  218 (320)
Q Consensus       198 ~ll~iL~~HElGH~~~Ar~~g  218 (320)
                      ......++||+||.+-.++..
T Consensus        94 ~~~~~~~~HElGH~LGl~H~~  114 (167)
T cd00203          94 KEGAQTIAHELGHALGFYHDH  114 (167)
T ss_pred             ccchhhHHHHHHHHhCCCccC
Confidence            346778899999999876554


No 34 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=50.01  E-value=7.4  Score=34.29  Aligned_cols=20  Identities=20%  Similarity=0.187  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHhCc
Q 020890          200 ITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv  219 (320)
                      .+..++||+||.+-+.+-+-
T Consensus       133 ~~~~~aHElGH~lG~~HD~~  152 (192)
T cd04267         133 TALTMAHELGHNLGAEHDGG  152 (192)
T ss_pred             ehhhhhhhHHhhcCCcCCCC
Confidence            46789999999998887654


No 35 
>PF14891 Peptidase_M91:  Effector protein
Probab=48.45  E-value=12  Score=33.28  Aligned_cols=19  Identities=5%  Similarity=-0.165  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHhC
Q 020890          200 ITILGVSEISTRLTAARYG  218 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~g  218 (320)
                      =++.+.|||+|.+-...=.
T Consensus       103 p~v~L~HEL~HA~~~~~Gt  121 (174)
T PF14891_consen  103 PFVVLYHELIHAYDYMNGT  121 (174)
T ss_pred             HHHHHHHHHHHHHHHHCCC
Confidence            3567899999998776433


No 36 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=47.74  E-value=11  Score=32.74  Aligned_cols=17  Identities=18%  Similarity=0.249  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHhCcc
Q 020890          204 GVSEISTRLTAARYGVK  220 (320)
Q Consensus       204 ~~HElGH~~~Ar~~gv~  220 (320)
                      +.||+.|.|.=|.||.-
T Consensus        83 L~HEL~H~WQ~RsYG~i   99 (141)
T PHA02456         83 LAHELNHAWQFRTYGLV   99 (141)
T ss_pred             HHHHHHHHHhhhcccee
Confidence            68999999999999974


No 37 
>PRK03001 M48 family peptidase; Provisional
Probab=47.62  E-value=12  Score=35.73  Aligned_cols=13  Identities=15%  Similarity=0.018  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||+-
T Consensus       124 l~aVlAHElgHi~  136 (283)
T PRK03001        124 IRGVMAHELAHVK  136 (283)
T ss_pred             HHHHHHHHHHHHh
Confidence            5678899999984


No 38 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=47.13  E-value=12  Score=29.60  Aligned_cols=13  Identities=15%  Similarity=0.143  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLTA  214 (320)
Q Consensus       202 iL~~HElGH~~~A  214 (320)
                      -+++||++|.+.=
T Consensus        63 ~llaHEl~Hv~Qq   75 (79)
T PF13699_consen   63 ALLAHELAHVVQQ   75 (79)
T ss_pred             hhHhHHHHHHHhh
Confidence            4689999998863


No 39 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=46.82  E-value=11  Score=33.25  Aligned_cols=19  Identities=21%  Similarity=0.032  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHhC
Q 020890          200 ITILGVSEISTRLTAARYG  218 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~g  218 (320)
                      ..-.++||+||.+--++-.
T Consensus       113 ~~~t~~HEiGHaLGL~H~~  131 (186)
T cd04277         113 GYQTIIHEIGHALGLEHPG  131 (186)
T ss_pred             hHHHHHHHHHHHhcCCCCC
Confidence            4567899999998765543


No 40 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=46.69  E-value=10  Score=31.64  Aligned_cols=16  Identities=13%  Similarity=0.096  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHhC
Q 020890          203 LGVSEISTRLTAARYG  218 (320)
Q Consensus       203 L~~HElGH~~~Ar~~g  218 (320)
                      .++||+||.+-.++-.
T Consensus        89 ~~~HEigHaLGl~H~~  104 (140)
T smart00235       89 VAAHELGHALGLYHEQ  104 (140)
T ss_pred             cHHHHHHHHhcCCcCC
Confidence            7899999998655433


No 41 
>PF12315 DUF3633:  Protein of unknown function (DUF3633);  InterPro: IPR022087  This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM. 
Probab=45.84  E-value=14  Score=34.82  Aligned_cols=30  Identities=13%  Similarity=0.019  Sum_probs=22.6

Q ss_pred             HHHhhHHHHHHHHHHHHHHHHHHHHHHHHhCcc
Q 020890          188 YLANVVPLFGGLITILGVSEISTRLTAARYGVK  220 (320)
Q Consensus       188 ~~~~glp~al~ll~iL~~HElGH~~~Ar~~gv~  220 (320)
                      .+..|+|-  .+++++++||++|.|. |-.|.+
T Consensus        83 lvl~GLPr--ll~gsiLAHE~mHa~L-rl~g~~  112 (212)
T PF12315_consen   83 LVLYGLPR--LLTGSILAHELMHAWL-RLNGFP  112 (212)
T ss_pred             EEECCCCH--HHHhhHHHHHHHHHHh-cccCCC
Confidence            46778884  4588999999999998 445543


No 42 
>PRK03982 heat shock protein HtpX; Provisional
Probab=44.95  E-value=14  Score=35.36  Aligned_cols=13  Identities=8%  Similarity=-0.036  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||+-
T Consensus       125 l~AVlAHElgHi~  137 (288)
T PRK03982        125 LEGVIAHELTHIK  137 (288)
T ss_pred             HHHHHHHHHHHHH
Confidence            5567899999974


No 43 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=44.87  E-value=11  Score=35.38  Aligned_cols=26  Identities=12%  Similarity=-0.047  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhC
Q 020890          193 VPLFGGLITILGVSEISTRLTAARYG  218 (320)
Q Consensus       193 lp~al~ll~iL~~HElGH~~~Ar~~g  218 (320)
                      -++..-...-+++|||||.+-=|+-+
T Consensus       126 ~~~~~~~~~hvi~HEiGH~IGfRHTD  151 (211)
T PF12388_consen  126 SNYSVNVIEHVITHEIGHCIGFRHTD  151 (211)
T ss_pred             CCCchhHHHHHHHHHhhhhccccccC
Confidence            44556667889999999999877755


No 44 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=43.07  E-value=17  Score=32.25  Aligned_cols=22  Identities=14%  Similarity=0.111  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhCc
Q 020890          198 GLITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       198 ~ll~iL~~HElGH~~~Ar~~gv  219 (320)
                      ..++..++||+||.+-..+-+-
T Consensus       129 ~~~a~~~AHelGH~lGm~HD~~  150 (199)
T PF01421_consen  129 LSFAVIIAHELGHNLGMPHDGD  150 (199)
T ss_dssp             HHHHHHHHHHHHHHTT---TTT
T ss_pred             HHHHHHHHHHHHHhcCCCCCCC
Confidence            3466788999999988777666


No 45 
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism]
Probab=42.37  E-value=44  Score=33.06  Aligned_cols=67  Identities=15%  Similarity=0.242  Sum_probs=47.0

Q ss_pred             ccCHhhHHHhhcccCc-ceEEEeeeeEeCCeEEEEccCCC--cHHHHHHHHHHHHHHHhCCCeEEEEEeecCC
Q 020890           58 SFKALDLNKLRGCFGF-DTFFATDVRRFGDGGIFIGNLRK--PIEEVIPKLEKKLSEAAGRDVVVWFMEEKTN  127 (320)
Q Consensus        58 ~~~~eDl~~lk~~Fg~-dtF~vte~~~~~~gvi~rGnLR~--~~e~v~~~L~~~L~~~fgd~y~l~l~e~~~~  127 (320)
                      ++-.|.++.||..+|- .+||++|+-.--+|.-+-++--.  +.++.++++...|++.   +|.+|+.|-.++
T Consensus       215 ~f~~~q~e~vqsa~g~~k~~~v~EtGWPS~G~~~G~a~pS~anq~~~~~~i~~~~~~~---G~d~fvfeAFdd  284 (305)
T COG5309         215 TFLLEQLERVQSACGTKKTVWVTETGWPSDGRTYGSAVPSVANQKIAVQEILNALRSC---GYDVFVFEAFDD  284 (305)
T ss_pred             HHHHHHHHHHHHhcCCCccEEEeeccCCCCCCccCCcCCChhHHHHHHHHHHhhhhcc---CccEEEeeeccc
Confidence            3334557788988887 99999999655555444443322  4567788888888776   888888887654


No 46 
>PRK04897 heat shock protein HtpX; Provisional
Probab=42.10  E-value=16  Score=35.29  Aligned_cols=13  Identities=23%  Similarity=-0.077  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||+-
T Consensus       137 l~aVlAHElgHi~  149 (298)
T PRK04897        137 LEGVIGHEISHIR  149 (298)
T ss_pred             HHHHHHHHHHHHh
Confidence            5567899999974


No 47 
>PRK02870 heat shock protein HtpX; Provisional
Probab=41.74  E-value=14  Score=36.81  Aligned_cols=19  Identities=16%  Similarity=0.212  Sum_probs=14.0

Q ss_pred             HHHHHHHHHHHHHHHHHhCccc
Q 020890          200 ITILGVSEISTRLTAARYGVKL  221 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv~~  221 (320)
                      +..+++||+||+   +++++..
T Consensus       173 L~aVlAHELgHi---k~~di~~  191 (336)
T PRK02870        173 LQAVMAHELSHI---RHGDIRL  191 (336)
T ss_pred             HHHHHHHHHHHH---HcccHHH
Confidence            556789999998   5555554


No 48 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=41.03  E-value=8.8  Score=35.06  Aligned_cols=16  Identities=19%  Similarity=-0.132  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHhCc
Q 020890          204 GVSEISTRLTAARYGV  219 (320)
Q Consensus       204 ~~HElGH~~~Ar~~gv  219 (320)
                      ++||+||.+-|++-+=
T Consensus       141 ~aHEiGH~lGl~H~~~  156 (206)
T PF13583_consen  141 FAHEIGHNLGLRHDFD  156 (206)
T ss_pred             HHHHHHHHhcCCCCcc
Confidence            7899999999987654


No 49 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=39.37  E-value=18  Score=31.79  Aligned_cols=11  Identities=18%  Similarity=0.311  Sum_probs=9.1

Q ss_pred             HHHHHHHHHHH
Q 020890          203 LGVSEISTRLT  213 (320)
Q Consensus       203 L~~HElGH~~~  213 (320)
                      +.+||+||.+-
T Consensus        80 IaaHE~GHiLG   90 (132)
T PF02031_consen   80 IAAHELGHILG   90 (132)
T ss_dssp             HHHHHHHHHHT
T ss_pred             eeeehhccccC
Confidence            57899999863


No 50 
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=39.13  E-value=14  Score=32.47  Aligned_cols=16  Identities=25%  Similarity=0.399  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          197 GGLITILGVSEISTRL  212 (320)
Q Consensus       197 l~ll~iL~~HElGH~~  212 (320)
                      .=.+...++||+||++
T Consensus       106 gd~vthvliHEIgHhF  121 (136)
T COG3824         106 GDQVTHVLIHEIGHHF  121 (136)
T ss_pred             hhHhhhhhhhhhhhhc
Confidence            4467899999999986


No 51 
>PRK01345 heat shock protein HtpX; Provisional
Probab=38.91  E-value=19  Score=35.23  Aligned_cols=13  Identities=8%  Similarity=0.015  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||.-
T Consensus       124 L~aVlAHElgHi~  136 (317)
T PRK01345        124 VAGVMAHELAHVK  136 (317)
T ss_pred             HHHHHHHHHHHHH
Confidence            5667899999986


No 52 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=38.80  E-value=20  Score=33.37  Aligned_cols=13  Identities=8%  Similarity=0.033  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||..
T Consensus       157 l~aVlaHElgHi~  169 (302)
T COG0501         157 LEAVLAHELGHIK  169 (302)
T ss_pred             HHHHHHHHHHHHh
Confidence            4457899999963


No 53 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=37.40  E-value=21  Score=32.55  Aligned_cols=20  Identities=20%  Similarity=0.130  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHhCcc
Q 020890          201 TILGVSEISTRLTAARYGVK  220 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar~~gv~  220 (320)
                      +..++||+||-+-+.+-+-.
T Consensus       146 ~~~~AHElGH~lG~~HD~~~  165 (220)
T cd04272         146 VYTMTHELAHLLGAPHDGSP  165 (220)
T ss_pred             HHHHHHHHHHHhCCCCCCCC
Confidence            48899999999988876543


No 54 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=37.14  E-value=21  Score=30.74  Aligned_cols=18  Identities=6%  Similarity=-0.180  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 020890          199 LITILGVSEISTRLTAAR  216 (320)
Q Consensus       199 ll~iL~~HElGH~~~Ar~  216 (320)
                      .+--.+.|||.|+++-..
T Consensus        58 ~l~~~l~HEm~H~~~~~~   75 (146)
T smart00731       58 RLRETLLHELCHAALYLF   75 (146)
T ss_pred             HHHhhHHHHHHHHHHHHh
Confidence            445588999999999753


No 55 
>PF13721 SecD-TM1:  SecD export protein N-terminal TM region
Probab=37.01  E-value=43  Score=27.63  Aligned_cols=52  Identities=19%  Similarity=0.139  Sum_probs=36.1

Q ss_pred             HHhhcccCcceEEEeeeeEeCCeEEEEccCCCcHHHHHHHHHHHHHHHhCCCeEEE
Q 020890           65 NKLRGCFGFDTFFATDVRRFGDGGIFIGNLRKPIEEVIPKLEKKLSEAAGRDVVVW  120 (320)
Q Consensus        65 ~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR~~~e~v~~~L~~~L~~~fgd~y~l~  120 (320)
                      +++++.+.-.---+.+++..++.+++|    =+.++---+-++-|++.+|++|.|-
T Consensus        49 ~~v~~~L~~~~I~~k~i~~~~~~llir----f~~~~~Ql~Ak~~L~~~L~~~y~VA  100 (101)
T PF13721_consen   49 FQVEQALKAAGIAVKSIEQEGDSLLIR----FDSTDQQLKAKDVLSKALGDDYVVA  100 (101)
T ss_pred             HHHHHHHHHCCCCcceEEeeCCEEEEE----ECCHHHHHHHHHHHHHHcCCCCEee
Confidence            466655555556667888888887776    3344444566777888899999873


No 56 
>PRK02391 heat shock protein HtpX; Provisional
Probab=36.88  E-value=22  Score=34.53  Aligned_cols=12  Identities=17%  Similarity=0.155  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 020890          200 ITILGVSEISTR  211 (320)
Q Consensus       200 l~iL~~HElGH~  211 (320)
                      +..+++||+||+
T Consensus       133 l~aVlaHElgHi  144 (296)
T PRK02391        133 LEAVLAHELSHV  144 (296)
T ss_pred             HHHHHHHHHHHH
Confidence            456789999995


No 57 
>PRK03072 heat shock protein HtpX; Provisional
Probab=36.56  E-value=22  Score=34.21  Aligned_cols=13  Identities=15%  Similarity=-0.041  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRL  212 (320)
Q Consensus       200 l~iL~~HElGH~~  212 (320)
                      +..+++||+||.-
T Consensus       127 l~aVlAHElgHi~  139 (288)
T PRK03072        127 LRGVLGHELSHVY  139 (288)
T ss_pred             HHHHHHHHHHHHh
Confidence            4567899999963


No 58 
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family. This family represents a conserved protein of bacterial type III secretion systems. Gene symbols are variable from species to species. Members are designated YscD in Yersinia, HrpQ in Pseudomonas syringae, and EscD in enteropathogenic Escherichia coli. In the Chlamydiae, this model describes the C-terminal 400 residues of a longer protein.
Probab=36.37  E-value=83  Score=31.79  Aligned_cols=44  Identities=14%  Similarity=0.065  Sum_probs=39.9

Q ss_pred             EeCCeEEEEccCCCcHHHHHHHHHHHHHHHhCCCeEEEEEeecC
Q 020890           83 RFGDGGIFIGNLRKPIEEVIPKLEKKLSEAAGRDVVVWFMEEKT  126 (320)
Q Consensus        83 ~~~~gvi~rGnLR~~~e~v~~~L~~~L~~~fgd~y~l~l~e~~~  126 (320)
                      ..++.+...|++..+..+.|+++.+++++++|..|.+.++.-+.
T Consensus       302 ~~~~~i~lsG~l~~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~  345 (410)
T TIGR02500       302 ESGREIALSGQLDSEKRSRLQELLAAFKQRDGVIPDVVLQNIPA  345 (410)
T ss_pred             ecCCEEEEEecCCHHHHHHHHHHHHHHHHhCCCCceEEEecCCc
Confidence            66779999999999999999999999999999989888887754


No 59 
>PRK05457 heat shock protein HtpX; Provisional
Probab=36.31  E-value=23  Score=34.17  Aligned_cols=12  Identities=25%  Similarity=0.185  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHH
Q 020890          200 ITILGVSEISTR  211 (320)
Q Consensus       200 l~iL~~HElGH~  211 (320)
                      +..+++||+||.
T Consensus       134 l~aVlAHElgHi  145 (284)
T PRK05457        134 VEAVLAHEISHI  145 (284)
T ss_pred             HHHHHHHHHHHH
Confidence            456789999996


No 60 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.19  E-value=27  Score=29.73  Aligned_cols=18  Identities=6%  Similarity=-0.147  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 020890          199 LITILGVSEISTRLTAAR  216 (320)
Q Consensus       199 ll~iL~~HElGH~~~Ar~  216 (320)
                      .+.-.+.|||.|+++-..
T Consensus        59 ~~~~tL~HEm~H~~~~~~   76 (157)
T PF10263_consen   59 ELIDTLLHEMAHAAAYVF   76 (157)
T ss_pred             HHHHHHHHHHHHHHhhhc
Confidence            566688999999998544


No 61 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=36.18  E-value=38  Score=31.92  Aligned_cols=25  Identities=12%  Similarity=0.061  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhCccc
Q 020890          196 FGGLITILGVSEISTRLTAARYGVKL  221 (320)
Q Consensus       196 al~ll~iL~~HElGH~~~Ar~~gv~~  221 (320)
                      +++-+...+.||+||.+... +++++
T Consensus        88 ~~~~~~~~l~HE~GHAlI~~-~~lPv  112 (220)
T PF14247_consen   88 AIGNVLFTLYHELGHALIDD-LDLPV  112 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-hcCCc
Confidence            67778888999999999875 45543


No 62 
>cd03513 CrtW_beta-carotene-ketolase Beta-carotene ketolase/oxygenase (CrtW, also known as CrtO), the carotenoid astaxanthin biosynthetic enzyme, initially catalyzes the addition of two keto groups to carbons C4 and C4' of beta-carotene. Carotenoids are important natural pigments produced by many microorganisms and plants. Astaxanthin is reported to be an antioxidant, an anti-cancer agent, and an immune system stimulant. A number of bacteria and green algae can convert beta-carotene into astaxanthin by using several ketocarotenoids as intermediates and CrtW and a beta-carotene hydroxylase (CrtZ). CrtW initially converts beta-carotene to canthaxanthin via echinenone, and CrtZ initially mediates the conversion of beta-carotene to zeaxanthin via beta-cryptoxanthin. After a few more intermediates are formed, CrtW and CrtZ act in combination to produce astaxanthin. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. Th
Probab=35.98  E-value=60  Score=30.43  Aligned_cols=18  Identities=6%  Similarity=-0.073  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHH-HHhCc
Q 020890          202 ILGVSEISTRLTA-ARYGV  219 (320)
Q Consensus       202 iL~~HElGH~~~A-r~~gv  219 (320)
                      .+++||.+|.-.+ ++..+
T Consensus        47 fi~~HDa~Hg~~~~~~~~~   65 (225)
T cd03513          47 FIIAHDAMHGSLAPGNPRL   65 (225)
T ss_pred             HHHHHHhhhhccccCCchH
Confidence            3689999999887 44433


No 63 
>PRK01265 heat shock protein HtpX; Provisional
Probab=35.67  E-value=23  Score=35.07  Aligned_cols=20  Identities=20%  Similarity=0.192  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHHhCcccc
Q 020890          200 ITILGVSEISTRLTAARYGVKLS  222 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv~~s  222 (320)
                      +..+++||+||+   |++++...
T Consensus       140 l~aVlAHElgHi---k~~d~~~~  159 (324)
T PRK01265        140 IKAVAGHELGHL---KHRDVELL  159 (324)
T ss_pred             HHHHHHHHHHHH---HcccHHHH
Confidence            456789999996   55555443


No 64 
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=35.30  E-value=21  Score=32.09  Aligned_cols=15  Identities=13%  Similarity=0.051  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLTAAR  216 (320)
Q Consensus       202 iL~~HElGH~~~Ar~  216 (320)
                      -..+||+||.+--.+
T Consensus        94 ~~i~HElgHaLG~~H  108 (198)
T cd04327          94 RVVLHEFGHALGFIH  108 (198)
T ss_pred             HHHHHHHHHHhcCcc
Confidence            467899999986543


No 65 
>PF09585 Lin0512_fam:  Conserved hypothetical protein (Lin0512_fam);  InterPro: IPR011719 This family consists of few members, broadly distributed. It occurs so far in several Firmicutes (twice in Oceanobacillus), one Cyanobacterium, one alpha Proteobacterium, and (with a long prefix) in plants. The function is unknown. The alignment includes a perfectly conserved motif GxGxDxHG near the N terminus.
Probab=34.44  E-value=19  Score=30.92  Aligned_cols=59  Identities=20%  Similarity=0.248  Sum_probs=42.0

Q ss_pred             CchhhhhhhhhccchHHHHhhhhhhhhccCHhhHHHhhcccCcceEEEeeeeEeCCeEEEEcc
Q 020890           31 NPIMRLFNRLVRDSLTREKERLEKAEESFKALDLNKLRGCFGFDTFFATDVRRFGDGGIFIGN   93 (320)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGn   93 (320)
                      |.+-+++..+-. +...|+-+++-.-+....-|.+++|.+||+.+   -+++-..+|.++.|.
T Consensus        33 nslp~l~~~~~~-~~~~M~v~V~igVp~pe~vD~e~v~~~~PyG~---~~v~vv~GGl~~sGi   91 (113)
T PF09585_consen   33 NSLPGLFEILGL-DLDDMKVEVKIGVPRPEKVDIEAVKAVFPYGQ---VTVEVVKGGLITSGI   91 (113)
T ss_pred             cchHHHHHHcCC-ChHHEEEEEEEeCCCccccCHHHHHHhCCCCC---ceEEEEcCCccccCc
Confidence            556556654444 55667777766666657789999999999998   556666777777774


No 66 
>cd03512 Alkane-hydroxylase Alkane hydroxylase is a bacterial, integral-membrane di-iron enzyme that shares a requirement for iron and oxygen for activity similar to that of the non-heme integral-membrane acyl coenzyme A (CoA) desaturases and acyl lipid desaturases. The alk genes in Pseudomonas oleovorans encode conversion of alkanes to acyl CoA. The alkane omega-hydroxylase (AlkB) system is responsible for the initial oxidation of inactivated alkanes. It is a three-component system comprising a soluble NADH-rubredoxin reductase (AlkT), a soluble rubredoxin (AlkG), and the integral membrane oxygenase (AlkB). AlkB utilizes the oxygen rebound mechanism to hydroxylate alkanes. This mechanism involves homolytic cleavage of the C-H bond by an electrophilic metal-oxo intermediate to generate a substrate-based radical. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. The active
Probab=34.14  E-value=99  Score=30.25  Aligned_cols=16  Identities=31%  Similarity=0.455  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          195 LFGGLITILGVSEIST  210 (320)
Q Consensus       195 ~al~ll~iL~~HElGH  210 (320)
                      ++.|.+++-.+||++|
T Consensus        81 ~~~g~i~~~~aHel~H   96 (314)
T cd03512          81 LLSGVIGINTAHELIH   96 (314)
T ss_pred             HHHHHhhHHHHHhccC
Confidence            3344455677888888


No 67 
>PF13796 Sensor:  Putative sensor
Probab=33.93  E-value=3.2e+02  Score=23.88  Aligned_cols=74  Identities=12%  Similarity=0.032  Sum_probs=45.1

Q ss_pred             HhhHHHHHHHHHHHHHHHHHHHH-HHHHhCcccccccccccccccccceeeecCCCCCCchhhhhhhhhhhHHHH
Q 020890          190 ANVVPLFGGLITILGVSEISTRL-TAARYGVKLSPSFLVPSNWTGCLGVMNNYESLLPNKKALFDIPVARTASAY  263 (320)
Q Consensus       190 ~~glp~al~ll~iL~~HElGH~~-~Ar~~gv~~slPyFIP~~~lGtfGav~~~~s~~p~r~alfdIaiAGPlag~  263 (320)
                      ..|+|.....+...-..=-.|+. +++..|+++..||--|.-.-|...-+.+.-+.+.+++++....+..|++-.
T Consensus        30 ~vGlpll~~~~~~~r~~a~~eR~r~~~~lg~~i~~p~~~~~~~~~~~~~~~~~l~d~~tWR~l~~~~l~~~lg~v  104 (181)
T PF13796_consen   30 GVGLPLLPLALAAARGFARLERRRARRLLGVPIPRPYRRPPPRPGWLARLRARLTDPATWRDLAYLLLHFPLGLV  104 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCHHHHHHHHhcCcchHHHHHHHHHHHHHHHH
Confidence            34666544433333333333444 444459999988864443455566666666678888999888887776543


No 68 
>PF09471 Peptidase_M64:  IgA Peptidase M64;  InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=33.08  E-value=25  Score=33.85  Aligned_cols=16  Identities=13%  Similarity=0.100  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          199 LITILGVSEISTRLTA  214 (320)
Q Consensus       199 ll~iL~~HElGH~~~A  214 (320)
                      -+.-+++||+||.+.-
T Consensus       215 ~~~~v~vHE~GHsf~~  230 (264)
T PF09471_consen  215 SFKQVVVHEFGHSFGG  230 (264)
T ss_dssp             THHHHHHHHHHHHTT-
T ss_pred             cccceeeeeccccccc
Confidence            3667889999998753


No 69 
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=32.43  E-value=32  Score=31.49  Aligned_cols=19  Identities=11%  Similarity=-0.036  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHhC
Q 020890          200 ITILGVSEISTRLTAARYG  218 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~g  218 (320)
                      --.+.+||.||.++|-..+
T Consensus        28 ~~~~A~HEAGhAvva~~l~   46 (213)
T PF01434_consen   28 KRRIAYHEAGHAVVAYLLP   46 (213)
T ss_dssp             HHHHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHHHHHHHhc
Confidence            3467899999999998765


No 70 
>KOG2719 consensus Metalloprotease [General function prediction only]
Probab=31.80  E-value=27  Score=36.20  Aligned_cols=41  Identities=5%  Similarity=-0.175  Sum_probs=22.1

Q ss_pred             HHHHHHHHHHHHHHHHHhCcccccccccccccccccceeeec
Q 020890          200 ITILGVSEISTRLTAARYGVKLSPSFLVPSNWTGCLGVMNNY  241 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv~~slPyFIP~~~lGtfGav~~~  241 (320)
                      +..+++||+||+-----.+- +..-++.=.+.++.||.+.+-
T Consensus       280 l~AVl~HELGHW~~~H~~K~-~ii~~~~l~l~~llF~~~~~~  320 (428)
T KOG2719|consen  280 LVAVLAHELGHWKLNHVLKN-IIIMQIHLFLEFLLFGFLYRN  320 (428)
T ss_pred             HHHHHHHHhhHHHHhhHHHH-HHHHHHHHHHHHHHHHHHHcC
Confidence            45678999999854322211 111111222457777777664


No 71 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=29.79  E-value=8.4  Score=36.09  Aligned_cols=16  Identities=13%  Similarity=0.036  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRLTAA  215 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar  215 (320)
                      ++..++||+||++--+
T Consensus       137 ~g~t~~HEvGH~lGL~  152 (225)
T cd04275         137 LGDTATHEVGHWLGLY  152 (225)
T ss_pred             ccceeEEeccceeeee
Confidence            4467899999997543


No 72 
>PRK09966 putative inner membrane diguanylate cyclase; Provisional
Probab=29.69  E-value=1.7e+02  Score=28.34  Aligned_cols=98  Identities=18%  Similarity=0.201  Sum_probs=49.2

Q ss_pred             hhhhhhhhcccCCCCchhhhhhhhhccchHHHHhhhhhhhhccCHhhHHHhhcccCcceEEEeeeeEeCCeEEEEccCCC
Q 020890           17 ADTKLKELDRESTDNPIMRLFNRLVRDSLTREKERLEKAEESFKALDLNKLRGCFGFDTFFATDVRRFGDGGIFIGNLRK   96 (320)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR~   96 (320)
                      .+++..++.+...-+|+++++|+-   .|..++++.-+.+..         ..++   ....-+++.+.+---.+|.  .
T Consensus       237 l~~~~~~l~~~a~~D~lTgl~nr~---~f~~~l~~~~~~~~~---------~~~~---~l~~i~id~f~~in~~~G~--~  299 (407)
T PRK09966        237 LQAKNAQLLRTALHDPLTGLANRA---AFRSGINTLMNNSDA---------RKTS---ALLFLDGDNFKYINDTWGH--A  299 (407)
T ss_pred             HHHHHHHHHHHhCcCCccCCccHH---HHHHHHHHHHHHhhc---------CCce---EEEEEECccchHHHhhhch--H
Confidence            344445566666667888888764   233333222111100         0111   1222333333332223332  3


Q ss_pred             cHHHHHHHHHHHHHHHhCCCeEEEEEeecCCCCCceEEEE
Q 020890           97 PIEEVIPKLEKKLSEAAGRDVVVWFMEEKTNDITKQACAV  136 (320)
Q Consensus        97 ~~e~v~~~L~~~L~~~fgd~y~l~l~e~~~~~~~~~vlvv  136 (320)
                      ..+++.+++.+.|++.+++...+.-..+     +++++++
T Consensus       300 ~gd~~l~~~a~~L~~~~~~~~~~~R~~~-----deF~ill  334 (407)
T PRK09966        300 TGDRVLIEIAKRLAEFGGLRHKAYRLGG-----DEFAMVL  334 (407)
T ss_pred             HHHHHHHHHHHHHHHhCCCCCEEEEEcc-----ceEEEEE
Confidence            5688999999999888776655543322     3566654


No 73 
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=28.97  E-value=32  Score=33.66  Aligned_cols=13  Identities=8%  Similarity=0.102  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLTA  214 (320)
Q Consensus       202 iL~~HElGH~~~A  214 (320)
                      .-++||+||.+-.
T Consensus       224 ~tl~HE~GHa~h~  236 (427)
T cd06459         224 FTLAHELGHAFHS  236 (427)
T ss_pred             HHHHHHhhHHHHH
Confidence            4578999997643


No 74 
>TIGR00275 flavoprotein, HI0933 family. The model when searched with a partial length search brings in proteins with a dinucleotide-binding motif (Rossman fold) over the initial 40 residues of the model, including oxidoreductases and dehydrogenases. Partially characterized members include an FAD-binding protein from Bacillus cereus and flavoprotein HI0933 from Haemophilus influenzae.
Probab=28.77  E-value=52  Score=32.66  Aligned_cols=66  Identities=14%  Similarity=0.264  Sum_probs=43.2

Q ss_pred             CCchhhhhhhhhccchHH---HHhhh--hhhhhccCHhhHHHhhcccCcceEEEeeeeEeCCeEEEEccCC
Q 020890           30 DNPIMRLFNRLVRDSLTR---EKERL--EKAEESFKALDLNKLRGCFGFDTFFATDVRRFGDGGIFIGNLR   95 (320)
Q Consensus        30 ~~~~~~~~~~~~~~~~~~---~~~~i--~~~ee~~~~eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR   95 (320)
                      ...+...++.+.-+.+-.   ++.+|  ++.-..++++|+++|-+.+---.|-++.+..+.++.+++|=..
T Consensus       283 ~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~lk~~~~~~~g~~~~~~a~vt~GGv~  353 (400)
T TIGR00275       283 KKTVKNILKGLLPKRLAELLLEQLGIDPDLPAAQLSKKEIKKLVQLLKNWPFTVSGTRGFKEAEVTAGGVS  353 (400)
T ss_pred             hhhHHHHhhhhhhHHHHHHHHHHcCCCCCCChHHCCHHHHHHHHHHHhCCEEEecCcCccceeEEecCccc
Confidence            444444444444444443   33333  3444567888999888655555699999999999999998443


No 75 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=28.77  E-value=43  Score=29.78  Aligned_cols=22  Identities=14%  Similarity=0.078  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 020890          193 VPLFGGLITILGVSEISTRLTA  214 (320)
Q Consensus       193 lp~al~ll~iL~~HElGH~~~A  214 (320)
                      -.+-.|.++.+++|||.|.+--
T Consensus        29 ~~~~yg~lG~ilahel~hafd~   50 (206)
T PF01431_consen   29 PALNYGGLGFILAHELMHAFDP   50 (206)
T ss_dssp             HHHHHHTHHHHHHHHHHHCTST
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3444677999999999998743


No 76 
>PF04228 Zn_peptidase:  Putative neutral zinc metallopeptidase;  InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=28.17  E-value=46  Score=32.62  Aligned_cols=15  Identities=7%  Similarity=0.027  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHH
Q 020890          201 TILGVSEISTRLTAA  215 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar  215 (320)
                      +-+++||.||.+...
T Consensus       171 ayVlAHEyGHHVQ~l  185 (292)
T PF04228_consen  171 AYVLAHEYGHHVQNL  185 (292)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            446899999998764


No 77 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=27.60  E-value=41  Score=27.83  Aligned_cols=16  Identities=31%  Similarity=0.256  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          197 GGLITILGVSEISTRL  212 (320)
Q Consensus       197 l~ll~iL~~HElGH~~  212 (320)
                      .-++-..++||+||++
T Consensus        70 ~~~I~~tlvhEiah~f   85 (97)
T PF06262_consen   70 AELIRDTLVHEIAHHF   85 (97)
T ss_dssp             HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            4457788999999986


No 78 
>PF01432 Peptidase_M3:  Peptidase family M3 This Prosite motif covers only the active site. This family belongs to family M3 of the peptidase classification.;  InterPro: IPR001567 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M3 (clan MA(E)), subfamilies M3A and M3B. The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. The Thimet oligopeptidase family, is a large family of archaeal, bacterial and eukaryotic oligopeptidases that cleave medium sized peptides. The group contains:  mitochondrial intermediate peptidase (3.4.24.59 from EC) Neurolysin, mitochondrial precursor, (3.4.24.16 from EC) Thimet oligopeptidase (3.4.24.15 from EC) Dipeptidyl carboxypeptidase (3.4.15.5 from EC) Oligopeptidase A (3.4.24.70 from EC) Oligoendopeptidase F ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QR4_B 3CE2_A 1Y79_1 2H1J_A 2H1N_A 2O36_A 1S4B_P 2O3E_A 1I1I_P.
Probab=27.55  E-value=39  Score=33.96  Aligned_cols=20  Identities=10%  Similarity=-0.062  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHhCcc
Q 020890          201 TILGVSEISTRLTAARYGVK  220 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar~~gv~  220 (320)
                      ...++||+||.+-.-.-+-+
T Consensus       243 v~tLfHE~GHa~H~~ls~~~  262 (458)
T PF01432_consen  243 VETLFHEFGHAMHSLLSRTK  262 (458)
T ss_dssp             HHHHHHHHHHHHHHHHCCCS
T ss_pred             HHHHHHHHhHHHHHHHhccc
Confidence            35689999999877665543


No 79 
>COG0819 TenA Putative transcription activator [Transcription]
Probab=27.24  E-value=72  Score=29.96  Aligned_cols=55  Identities=20%  Similarity=0.280  Sum_probs=42.7

Q ss_pred             hhhhhhcccCCCCchhhhhhhhhccchHH----HHhhhhhhhhccCHhhHHHhhcccCc
Q 020890           19 TKLKELDRESTDNPIMRLFNRLVRDSLTR----EKERLEKAEESFKALDLNKLRGCFGF   73 (320)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~i~~~ee~~~~eDl~~lk~~Fg~   73 (320)
                      .++++..+.+.++|-..-++.-+.+.+..    ....+++.-+..+++|+++++++|-.
T Consensus       144 ~~~~~~~~~~~~~~Y~~Wi~~Y~s~ef~~~v~~~~~~ld~~~~~~~~~~~~~l~~iF~~  202 (218)
T COG0819         144 KRLKAKPRASPNPPYQEWIDTYASEEFQEAVEELEALLDSLAENSSEEELEKLKQIFLT  202 (218)
T ss_pred             HHHHhccccCCCCcHHHHHHHcCCHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHH
Confidence            45666677778899999999999888774    45556666667788999999998854


No 80 
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=27.09  E-value=66  Score=34.51  Aligned_cols=38  Identities=8%  Similarity=0.026  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHHHHhC--cccccccccccccccccceeeec
Q 020890          201 TILGVSEISTRLTAARYG--VKLSPSFLVPSNWTGCLGVMNNY  241 (320)
Q Consensus       201 ~iL~~HElGH~~~Ar~~g--v~~slPyFIP~~~lGtfGav~~~  241 (320)
                      -....||.||.+++..+.  .++.-...+|.   |.-++++.+
T Consensus       409 ~~~a~he~gha~~~~~~~~~~~~~~v~i~pr---g~~~g~~~~  448 (644)
T PRK10733        409 ESTAYHEAGHAIIGRLVPEHDPVHKVTIIPR---GRALGVTFF  448 (644)
T ss_pred             HHHHHHHHHHHHHHHHccCCCceeEEEEecc---CCCcceeEE
Confidence            567899999999998763  44444455666   333444443


No 81 
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=26.61  E-value=38  Score=35.33  Aligned_cols=13  Identities=8%  Similarity=-0.079  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHH
Q 020890          201 TILGVSEISTRLT  213 (320)
Q Consensus       201 ~iL~~HElGH~~~  213 (320)
                      ...++||+||.+-
T Consensus       338 v~TL~HElGHa~H  350 (549)
T TIGR02289       338 IDVLTHEAGHAFH  350 (549)
T ss_pred             HHHHHHHhhHHHH
Confidence            3467999999973


No 82 
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=26.53  E-value=38  Score=35.59  Aligned_cols=18  Identities=22%  Similarity=0.043  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHHHhCc
Q 020890          200 ITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv  219 (320)
                      ++.+++||+||.  +.+|-+
T Consensus       130 lagViAHEigHv--~qrH~a  147 (484)
T COG4783         130 LAGVIAHEIGHV--AQRHLA  147 (484)
T ss_pred             HHHHHHHHHHHH--hhhhHH
Confidence            577899999995  344433


No 83 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=25.66  E-value=45  Score=29.45  Aligned_cols=11  Identities=18%  Similarity=0.283  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHH
Q 020890          203 LGVSEISTRLT  213 (320)
Q Consensus       203 L~~HElGH~~~  213 (320)
                      +.+|||+|-++
T Consensus       138 VvaHEltHGVt  148 (150)
T PF01447_consen  138 VVAHELTHGVT  148 (150)
T ss_dssp             HHHHHHHHHHH
T ss_pred             eeeeccccccc
Confidence            57899999875


No 84 
>PRK07650 4-amino-4-deoxychorismate lyase; Provisional
Probab=25.25  E-value=79  Score=29.76  Aligned_cols=78  Identities=14%  Similarity=0.147  Sum_probs=51.8

Q ss_pred             hhhhhhhccchHH--HHhhhhhhhhccCHhhHHHhhcccCcceE-EEeeeeEeCCeEEEEccCCCcHHHHHHHHHHHHHH
Q 020890           35 RLFNRLVRDSLTR--EKERLEKAEESFKALDLNKLRGCFGFDTF-FATDVRRFGDGGIFIGNLRKPIEEVIPKLEKKLSE  111 (320)
Q Consensus        35 ~~~~~~~~~~~~~--~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF-~vte~~~~~~gvi~rGnLR~~~e~v~~~L~~~L~~  111 (320)
                      ++++...|..+-.  ++++++-.|++++++|+..-.+||=.++. -+..+...++. .+.    +++..+.+++++.+.+
T Consensus       199 g~L~GitR~~li~~~~~~g~~v~e~~i~~~dL~~adeifl~ns~~gv~pV~~i~~~-~~~----g~~g~~~~~l~~~~~~  273 (283)
T PRK07650        199 GILNGITRAFVIKVLEELGIEVKEGFYTKEELLSADEVFVTNSIQEIVPLTRIEER-DFP----GKVGMVTKRLQNLYEM  273 (283)
T ss_pred             CCcccHHHHHHHHHHHHcCCeEEEEecCHHHHhhCCEeeeecCcccEEEEEEECCE-EeC----CCCCHHHHHHHHHHHH
Confidence            3566666666553  56677888899999999999999887775 45556555543 332    4555666666666655


Q ss_pred             HhCCCe
Q 020890          112 AAGRDV  117 (320)
Q Consensus       112 ~fgd~y  117 (320)
                      ...+.|
T Consensus       274 ~~~~~~  279 (283)
T PRK07650        274 QREKLW  279 (283)
T ss_pred             HHHhhh
Confidence            544443


No 85 
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=24.72  E-value=37  Score=32.86  Aligned_cols=13  Identities=8%  Similarity=-0.092  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHH
Q 020890          203 LGVSEISTRLTAA  215 (320)
Q Consensus       203 L~~HElGH~~~Ar  215 (320)
                      -+.||+||.+-..
T Consensus       157 tl~HE~GHa~h~~  169 (365)
T cd06258         157 TLFHEFGHAVHFL  169 (365)
T ss_pred             HHHHHHhHHHHHH
Confidence            4689999998554


No 86 
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=24.49  E-value=28  Score=32.45  Aligned_cols=16  Identities=19%  Similarity=0.071  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHh
Q 020890          202 ILGVSEISTRLTAARY  217 (320)
Q Consensus       202 iL~~HElGH~~~Ar~~  217 (320)
                      ..++|||||-+-+.+-
T Consensus       147 ~t~AHElGHnLGm~HD  162 (228)
T cd04271         147 QVFAHEIGHTFGAVHD  162 (228)
T ss_pred             eehhhhhhhhcCCCCC
Confidence            6899999999988744


No 87 
>PF04315 DUF462:  Protein of unknown function, DUF462;  InterPro: IPR007411 This family consists of bacterial proteins of uncharacterised function.
Probab=24.42  E-value=48  Score=30.22  Aligned_cols=16  Identities=25%  Similarity=0.270  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHH--HHhCc
Q 020890          204 GVSEISTRLTA--ARYGV  219 (320)
Q Consensus       204 ~~HElGH~~~A--r~~gv  219 (320)
                      ..||++|+-+|  +|+.+
T Consensus        45 ALHEIaHWciAG~~RR~l   62 (164)
T PF04315_consen   45 ALHEIAHWCIAGPERRQL   62 (164)
T ss_pred             HHHHHHHHHhcccccccc
Confidence            46999999999  44443


No 88 
>TIGR00181 pepF oligoendopeptidase F. This family represents the oligoendopeptidase F clade of the family of larger M3 or thimet (for thiol-dependent metallopeptidase) oligopeptidase family. Lactococcus lactis PepF hydrolyzed peptides of 7 and 17 amino acids with fairly broad specificity. The homolog of lactococcal PepF in group B Streptococcus was named PepB (PubMed:8757883), with the name difference reflecting a difference in species of origin rather activity; substrate profiles were quite similar. Differences in substrate specificity should be expected in other species. The gene is duplicated in Lactococcus lactis on the plasmid that bears it. A shortened second copy is found in Bacillus subtilis.
Probab=24.38  E-value=41  Score=35.13  Aligned_cols=12  Identities=8%  Similarity=0.122  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHH
Q 020890          201 TILGVSEISTRL  212 (320)
Q Consensus       201 ~iL~~HElGH~~  212 (320)
                      ..-++||+||.+
T Consensus       379 v~TLaHElGHa~  390 (591)
T TIGR00181       379 VFTLAHELGHSM  390 (591)
T ss_pred             HHHHHHHhhhHH
Confidence            356799999987


No 89 
>PRK04860 hypothetical protein; Provisional
Probab=23.34  E-value=78  Score=28.38  Aligned_cols=22  Identities=18%  Similarity=0.235  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhC
Q 020890          197 GGLITILGVSEISTRLTAARYG  218 (320)
Q Consensus       197 l~ll~iL~~HElGH~~~Ar~~g  218 (320)
                      ..++--++.||++||++=..+|
T Consensus        60 ~~~l~~~v~HEl~H~~~~~~~g   81 (160)
T PRK04860         60 QAFIDEVVPHELAHLLVYQLFG   81 (160)
T ss_pred             HHHHHhHHHHHHHHHHHHHHcC
Confidence            3566777899999999998877


No 90 
>PRK10629 EnvZ/OmpR regulon moderator; Provisional
Probab=23.33  E-value=1.3e+02  Score=25.93  Aligned_cols=60  Identities=7%  Similarity=-0.033  Sum_probs=41.3

Q ss_pred             hhHHHhhcccCcceEEEeeeeEeCCeEEEEccCCCcHHHHHHHHHHHHHHHhCCCeEEEEEeec
Q 020890           62 LDLNKLRGCFGFDTFFATDVRRFGDGGIFIGNLRKPIEEVIPKLEKKLSEAAGRDVVVWFMEEK  125 (320)
Q Consensus        62 eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR~~~e~v~~~L~~~L~~~fgd~y~l~l~e~~  125 (320)
                      .|..++++.+--.---+.+++..++.+++|    =+.++---+-++-|++.+||+|.+-+...+
T Consensus        50 ~~~~~v~~~L~~~gI~~ksi~~~~~~~~ir----f~~~~~Ql~Ak~vL~~~L~~~y~VAlnl~p  109 (127)
T PRK10629         50 PDGFYVYQHLDANGIHIKSITPENDSLLIR----FDSPEQSAAAKEVLDRTLPHGYIIAQQDDN  109 (127)
T ss_pred             chHHHHHHHHHHCCCCcceEEeeCCEEEEE----ECCHHHHHHHHHHHHHHcCCCCEEEEecCC
Confidence            456666665555555677788888887776    333344466677888899999988776654


No 91 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=23.08  E-value=57  Score=30.04  Aligned_cols=19  Identities=16%  Similarity=0.144  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 020890          198 GLITILGVSEISTRLTAAR  216 (320)
Q Consensus       198 ~ll~iL~~HElGH~~~Ar~  216 (320)
                      ..+...++||+||.+--++
T Consensus       114 ~~~~~~~~he~gh~lGl~h  132 (197)
T cd04276         114 ASLRYLLAHEVGHTLGLRH  132 (197)
T ss_pred             HHHHHHHHHHHHHHhcCcc
Confidence            5567789999999986554


No 92 
>PRK10245 adrA diguanylate cyclase AdrA; Provisional
Probab=22.21  E-value=2.3e+02  Score=27.86  Aligned_cols=80  Identities=20%  Similarity=0.231  Sum_probs=41.0

Q ss_pred             hhcccCCCCchhhhhhhhh-ccchHHHHhhhhhhhhccCHhhHHHhhcccCcceEEEeeeeEeCCeEEEEccCCCcHHHH
Q 020890           23 ELDRESTDNPIMRLFNRLV-RDSLTREKERLEKAEESFKALDLNKLRGCFGFDTFFATDVRRFGDGGIFIGNLRKPIEEV  101 (320)
Q Consensus        23 ~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR~~~e~v  101 (320)
                      ++++...-+|+++++|+-. .+.+.++.++..+...+               -+..+-+++.+.+----.|.  ...+++
T Consensus       200 ~l~~~a~~D~LTGL~NR~~f~~~l~~~l~~~~~~~~~---------------~~ll~idId~Fk~INd~~Gh--~~GD~l  262 (366)
T PRK10245        200 RLQVMSTRDGMTGVYNRRHWETLLRNEFDNCRRHHRD---------------ATLLIIDIDHFKSINDTWGH--DVGDEA  262 (366)
T ss_pred             HHHHHhCcCCccCCCCHHHHHHHHHHHHHHHHhcCCC---------------EEEEEEECCcchHHHHhhCc--hHHHHH
Confidence            3444455689999999743 22233333322221100               11222333333332222232  246788


Q ss_pred             HHHHHHHHHHHhCCCeEE
Q 020890          102 IPKLEKKLSEAAGRDVVV  119 (320)
Q Consensus       102 ~~~L~~~L~~~fgd~y~l  119 (320)
                      .+++.+.|++.+++.-.+
T Consensus       263 L~~vA~~L~~~l~~~d~l  280 (366)
T PRK10245        263 IVALTRQLQITLRGSDVI  280 (366)
T ss_pred             HHHHHHHHHHhCCCCCEE
Confidence            899999999888766443


No 93 
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than Pfam model pfam05547.
Probab=22.14  E-value=21  Score=34.21  Aligned_cols=12  Identities=17%  Similarity=0.083  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHH
Q 020890          201 TILGVSEISTRL  212 (320)
Q Consensus       201 ~iL~~HElGH~~  212 (320)
                      .-+++||+||.+
T Consensus       166 igv~~HE~gH~l  177 (286)
T TIGR03296       166 VGVIAHELGHDL  177 (286)
T ss_pred             eeeeehhhhccc
Confidence            456799999954


No 94 
>PLN02259 branched-chain-amino-acid aminotransferase 2
Probab=22.00  E-value=99  Score=31.31  Aligned_cols=73  Identities=14%  Similarity=0.105  Sum_probs=51.1

Q ss_pred             hhhhhhccchHH--HHhhhhhhhhccCHhhHHHhhcccCcceE----EEeeeeEeCCeEEEEccCCCcHHHHHHHHHHHH
Q 020890           36 LFNRLVRDSLTR--EKERLEKAEESFKALDLNKLRGCFGFDTF----FATDVRRFGDGGIFIGNLRKPIEEVIPKLEKKL  109 (320)
Q Consensus        36 ~~~~~~~~~~~~--~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF----~vte~~~~~~gvi~rGnLR~~~e~v~~~L~~~L  109 (320)
                      +++.+.|+++-.  +..+++-.|++++.+||.+-.+||.-+|-    -|.++.+.+..+.+.+.    +.++.++|++.+
T Consensus       294 iL~GITR~sIl~la~~~G~~V~Er~i~~~eL~~AdEvF~tgTa~~V~PV~~I~~~~~~~~~~~~----~g~~t~~L~~~l  369 (388)
T PLN02259        294 ILEGITRKSVMEIASDQGYQVVEKAVHVDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTG----DESVCQKLRSVL  369 (388)
T ss_pred             cCcCHHHHHHHHHHHHCCCeEEEEECCHHHHHhCCEEEEcCCcceEEEEEEEecCCceEEeCCC----CCHHHHHHHHHH
Confidence            566666666653  55678888999999999999999999986    34444433344444321    237888888888


Q ss_pred             HHH
Q 020890          110 SEA  112 (320)
Q Consensus       110 ~~~  112 (320)
                      ...
T Consensus       370 ~~i  372 (388)
T PLN02259        370 VGI  372 (388)
T ss_pred             HHH
Confidence            777


No 95 
>PF04155 Ground-like:  Ground-like domain;  InterPro: IPR007284  This group of proteins contain one or more copies of the ground-like domain, which are specific to Caenorhabditis elegans and Caenorhabditis briggsae. It has been proposed that the ground-like domain containing proteins may bind and modulate the activity of Patched-like membrane molecules, reminiscent of the modulating activities of neuropeptides []. 
Probab=21.97  E-value=1.5e+02  Score=22.84  Aligned_cols=29  Identities=14%  Similarity=0.040  Sum_probs=25.9

Q ss_pred             CcHHHHHHHHHHHHHHHhCCCeEEEEEee
Q 020890           96 KPIEEVIPKLEKKLSEAAGRDVVVWFMEE  124 (320)
Q Consensus        96 ~~~e~v~~~L~~~L~~~fgd~y~l~l~e~  124 (320)
                      .++..+-+.|++.++++||.+|.|+.-++
T Consensus        22 ~~~~~s~~~Iq~~~e~~f~~~f~vIcs~~   50 (76)
T PF04155_consen   22 CNLSISKRAIQKAAEKRFGGSFEVICSEG   50 (76)
T ss_pred             CCHHHHHHHHHHHHHHHhCCCEEEEEeCC
Confidence            78889999999999999999999997655


No 96 
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=21.93  E-value=13  Score=33.57  Aligned_cols=20  Identities=15%  Similarity=0.042  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHhCc
Q 020890          200 ITILGVSEISTRLTAARYGV  219 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar~~gv  219 (320)
                      .+..++||+||.+-+.+-+-
T Consensus       140 ~a~~~aHElGH~LG~~HD~~  159 (207)
T cd04273         140 SAFTIAHELGHVLGMPHDGD  159 (207)
T ss_pred             eEEeeeeechhhcCCCCCCC
Confidence            36789999999998876654


No 97 
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family. The M3 family of metallopeptidases contains several distinct clades. Oligoendopeptidase F as characterized in Lactococcus, the functionally equivalent oligoendopeptidase B of group B Streptococcus, and closely related sequences are described by TIGR00181. The present family is quite similar but forms a distinct clade, and a number of species have one member of each. A greater sequence difference separates members of TIGR02289, probable oligoendopeptidases of the M3 family that probably should not be designated PepF.
Probab=21.76  E-value=52  Score=34.50  Aligned_cols=12  Identities=8%  Similarity=-0.053  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLT  213 (320)
Q Consensus       202 iL~~HElGH~~~  213 (320)
                      .-++||+||.+-
T Consensus       377 ~TL~HE~GHa~H  388 (587)
T TIGR02290       377 STLAHELGHAYH  388 (587)
T ss_pred             HHHHHHhhHHHH
Confidence            457999999983


No 98 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=21.48  E-value=58  Score=30.93  Aligned_cols=14  Identities=14%  Similarity=0.287  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHH
Q 020890          202 ILGVSEISTRLTAA  215 (320)
Q Consensus       202 iL~~HElGH~~~Ar  215 (320)
                      .+.+||.||.+.=.
T Consensus        91 aVAAHEvGHAiQ~a  104 (222)
T PF04298_consen   91 AVAAHEVGHAIQHA  104 (222)
T ss_pred             HHHHHHHhHHHhcc
Confidence            35789999998744


No 99 
>PLN02782 Branched-chain amino acid aminotransferase
Probab=21.16  E-value=1.3e+02  Score=30.52  Aligned_cols=75  Identities=15%  Similarity=0.170  Sum_probs=52.0

Q ss_pred             hhhhhhccchHH--HHhhhhhhhhccCHhhHHHhhcccCcceE-EEeeeeEe--CCeEEEEccCCCcHHHHHHHHHHHHH
Q 020890           36 LFNRLVRDSLTR--EKERLEKAEESFKALDLNKLRGCFGFDTF-FATDVRRF--GDGGIFIGNLRKPIEEVIPKLEKKLS  110 (320)
Q Consensus        36 ~~~~~~~~~~~~--~~~~i~~~ee~~~~eDl~~lk~~Fg~dtF-~vte~~~~--~~gvi~rGnLR~~~e~v~~~L~~~L~  110 (320)
                      ++..+.|+++-.  +.++++-.|++++.+|+.+-.+||.-+|- -++-+...  ++.-+..|+  +.+-.+.++|++.+.
T Consensus       308 iLpGITR~svlela~~~Gi~V~Er~i~~~eL~~AdEvF~tgTa~~V~PV~~I~~~g~~~~~~~--g~~Gpvt~~L~~~l~  385 (403)
T PLN02782        308 ILPGITRKSIIDVARSQGFQVEERNVTVDELLEADEVFCTGTAVVVSPVGSITYKGKRVSYGE--GGFGTVSQQLYTVLT  385 (403)
T ss_pred             cCcCHHHHHHHHHHHHcCCeEEEEECCHHHHhhCCEEEEccCcceEEEEEEEEECCEEEeCCC--CCcCHHHHHHHHHHH
Confidence            566666666654  55678888999999999999999998885 44444433  444333454  345567788888887


Q ss_pred             HH
Q 020890          111 EA  112 (320)
Q Consensus       111 ~~  112 (320)
                      +.
T Consensus       386 ~i  387 (403)
T PLN02782        386 SL  387 (403)
T ss_pred             HH
Confidence            76


No 100
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24.15; soluble metallo-endopeptidase; EC 3.4.24.15) family also includes neurolysin (endopeptidase 24.16, microsomal endopeptidase, mitochondrial oligopeptidase M, neurotensin endopeptidase, soluble angiotensin II-binding protein, thimet oligopeptidase II) which hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A. TOP and neurolysin are neuropeptidases expressed abundantly in the testis, but also found in the liver, lung and kidney. They are involved in the metabolism of neuropeptides under 20 amino acid residues long and cleave most bioactive peptides at the same sites, but recognize different positions on some naturally occurring and synthetic peptides; they cleave at distinct sites on the 13-residue bioactive peptide neurotensin, which modulates central dopaminergic and cholinergic circuits.  TOP has been shown to degrade peptides released by the proteasom
Probab=20.87  E-value=60  Score=33.24  Aligned_cols=25  Identities=20%  Similarity=0.101  Sum_probs=18.9

Q ss_pred             cHHHHHHHHHHHHHHHhCCCeEEEE
Q 020890           97 PIEEVIPKLEKKLSEAAGRDVVVWF  121 (320)
Q Consensus        97 ~~e~v~~~L~~~L~~~fgd~y~l~l  121 (320)
                      +-+++.+.+.+-+++.||.+|.-..
T Consensus       157 ~~~~~~~~i~~~~~~lfg~~~~~~~  181 (472)
T cd06455         157 PLEVVIEGMLDIYQRLFGLRFEEVP  181 (472)
T ss_pred             cHHHHHHHHHHHHHHHhCeEEEeCC
Confidence            5667888888888777998886553


No 101
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=20.73  E-value=70  Score=29.14  Aligned_cols=26  Identities=15%  Similarity=0.142  Sum_probs=21.9

Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHhhC
Q 020890          252 FDIPVARTASAYLTSLALAVAAFVAD  277 (320)
Q Consensus       252 fdIaiAGPlag~~~al~~~~~Gl~ls  277 (320)
                      -.-+.+|.++|.+-+++++++|.+.|
T Consensus       109 ~~~~~~g~IaGIvsav~valvGAvsS  134 (169)
T PF12301_consen  109 DGEAEAGTIAGIVSAVVVALVGAVSS  134 (169)
T ss_pred             ccCcccchhhhHHHHHHHHHHHHHHH
Confidence            34568999999999999999997766


No 102
>KOG1047 consensus Bifunctional leukotriene A4 hydrolase/aminopeptidase LTA4H [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Defense mechanisms; Amino acid transport and metabolism]
Probab=20.62  E-value=48  Score=35.68  Aligned_cols=16  Identities=19%  Similarity=0.136  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHH
Q 020890          200 ITILGVSEISTRLTAA  215 (320)
Q Consensus       200 l~iL~~HElGH~~~Ar  215 (320)
                      ++.+++||++|.|...
T Consensus       288 l~~vIaHEIAHSWtGN  303 (613)
T KOG1047|consen  288 LVDVIAHEIAHSWTGN  303 (613)
T ss_pred             hhhHHHHHhhhhhccc
Confidence            4789999999999753


No 103
>PF10692 DUF2498:  Protein of unknown function (DUF2498);  InterPro: IPR019633  This entry represents proteins found in gammaproteobacteria, including YciN from Escherichia coli. Their function is not known. ; PDB: 3M92_A.
Probab=20.60  E-value=3.8e+02  Score=21.92  Aligned_cols=44  Identities=23%  Similarity=0.224  Sum_probs=28.9

Q ss_pred             eEEEeeeeEeCCeEEEEccCCCc--------HHHHHHHHHHHHHHHhCCCeEE
Q 020890           75 TFFATDVRRFGDGGIFIGNLRKP--------IEEVIPKLEKKLSEAAGRDVVV  119 (320)
Q Consensus        75 tF~vte~~~~~~gvi~rGnLR~~--------~e~v~~~L~~~L~~~fgd~y~l  119 (320)
                      .-.+++++..++..+|||+-=-|        ...|| .+-+.|.-.+.++|.+
T Consensus        29 GM~a~~Veqk~~VLVFkGeyFLD~~GlPT~KtTAvF-NmFK~LAh~LS~~y~L   80 (82)
T PF10692_consen   29 GMRATSVEQKGDVLVFKGEYFLDEQGLPTAKTTAVF-NMFKHLAHVLSEKYHL   80 (82)
T ss_dssp             T--EEEEEECTTEEEEEE-----TTS---HHHHHHH-HHHHHHHHHHCCCEEE
T ss_pred             cccccceeeECCEEEEecceeecCCCCCCcchHHHH-HHHHHHHHHcCcceEe
Confidence            35799999999999999975322        22344 4667777788888976


No 104
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=20.54  E-value=52  Score=29.93  Aligned_cols=16  Identities=13%  Similarity=-0.004  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHh
Q 020890          202 ILGVSEISTRLTAARY  217 (320)
Q Consensus       202 iL~~HElGH~~~Ar~~  217 (320)
                      -..+||+||.+--.+-
T Consensus       127 k~~~HElGH~lGL~HC  142 (179)
T PRK13267        127 KEVTHELGHTLGLEHC  142 (179)
T ss_pred             HHHHHHHHHHcCCccC
Confidence            3479999999765543


No 105
>KOG2661 consensus Peptidase family M48 [Posttranslational modification, protein turnover, chaperones]
Probab=20.52  E-value=70  Score=32.65  Aligned_cols=18  Identities=22%  Similarity=0.215  Sum_probs=13.1

Q ss_pred             cccCcceEEEeeeeEeCC
Q 020890           69 GCFGFDTFFATDVRRFGD   86 (320)
Q Consensus        69 ~~Fg~dtF~vte~~~~~~   86 (320)
                      +..+..+||.|..|..+=
T Consensus       156 G~~~~~vfyfthlE~~Pi  173 (424)
T KOG2661|consen  156 GLLLFVVFYFTHLEVSPI  173 (424)
T ss_pred             hccceEEEEEeeeeeecc
Confidence            334489999998877664


No 106
>PF12046 DUF3529:  Protein of unknown function (DUF3529);  InterPro: IPR021919  This family of proteins is functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 176 to 190 amino acids in length. 
Probab=20.43  E-value=32  Score=31.51  Aligned_cols=48  Identities=13%  Similarity=0.095  Sum_probs=38.1

Q ss_pred             CHhhHHHhhcccCcceEEEeeeeEeCCeEEEEccCCCcH-HHHHHHHHH
Q 020890           60 KALDLNKLRGCFGFDTFFATDVRRFGDGGIFIGNLRKPI-EEVIPKLEK  107 (320)
Q Consensus        60 ~~eDl~~lk~~Fg~dtF~vte~~~~~~gvi~rGnLR~~~-e~v~~~L~~  107 (320)
                      +++-+++|++-|--.-|-+++.++.++.+.|+|+.+... ..+|=.+..
T Consensus        42 ~~~~~~~l~~yf~~r~y~v~~~d~~~~~itFeG~V~pS~~lA~fLt~l~   90 (173)
T PF12046_consen   42 PDEVLEQLKAYFEQRNYRVAEGDAEGEVITFEGFVAPSWFLAIFLTFLA   90 (173)
T ss_pred             HHHHHHHHHHHHHhcCceecccCccccEEEEEEEecCcHhHHHHHHHHH
Confidence            556678899999999999999999999999999998754 334444433


No 107
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=20.31  E-value=53  Score=29.29  Aligned_cols=16  Identities=19%  Similarity=-0.137  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHHh
Q 020890          202 ILGVSEISTRLTAARY  217 (320)
Q Consensus       202 iL~~HElGH~~~Ar~~  217 (320)
                      -..+||+||.+-..+-
T Consensus        76 g~v~HE~~HalG~~HE   91 (180)
T cd04280          76 GTIVHELMHALGFYHE   91 (180)
T ss_pred             chhHHHHHHHhcCcch
Confidence            3578999999765443


No 108
>PF14552 Tautomerase_2:  Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C.
Probab=20.05  E-value=1.1e+02  Score=24.42  Aligned_cols=34  Identities=24%  Similarity=0.434  Sum_probs=21.9

Q ss_pred             ccCCCcHHHHHHHHHHHHHHHhC---CCeEEEEEeec
Q 020890           92 GNLRKPIEEVIPKLEKKLSEAAG---RDVVVWFMEEK  125 (320)
Q Consensus        92 GnLR~~~e~v~~~L~~~L~~~fg---d~y~l~l~e~~  125 (320)
                      |+-...-++.|+.|.++|++..|   +...+.++|.+
T Consensus        39 gRs~e~K~~ly~~l~~~L~~~~gi~p~Dv~I~l~e~~   75 (82)
T PF14552_consen   39 GRSTEQKKALYRALAERLAEKLGIRPEDVMIVLVENP   75 (82)
T ss_dssp             ---HHHHHHHHHHHHHHHHHHH---GGGEEEEEEEE-
T ss_pred             CCCHHHHHHHHHHHHHHHHHHcCCCHHHEEEEEEECC
Confidence            55445667899999999998876   44666666654


Done!