BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020906
         (320 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2BOY|A Chain A, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|B Chain B, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|C Chain C, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|D Chain D, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|E Chain E, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|F Chain F, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|G Chain G, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
 pdb|2BOY|H Chain H, Crystal Structure Of 3-Chlorocatechol 1,2-Dioxygenase From
           Rhodococcus Opacus 1cp
          Length = 254

 Score = 28.5 bits (62), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 13/61 (21%)

Query: 11  LPVSEPARGDEGEKERLLKGDEKLFRGSAMTRRGANAAISYMACAVLLVMFNKAALSSYN 70
           +P + P R DE        GD  +FRG  + + GA  A       VLL M+   A   Y+
Sbjct: 88  IPYTMPMRDDE-------SGDTLIFRGEVVDQEGAPLA------DVLLDMWQADAAGEYS 134

Query: 71  F 71
           F
Sbjct: 135 F 135


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.139    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,143,165
Number of Sequences: 62578
Number of extensions: 287607
Number of successful extensions: 557
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 557
Number of HSP's gapped (non-prelim): 1
length of query: 320
length of database: 14,973,337
effective HSP length: 99
effective length of query: 221
effective length of database: 8,778,115
effective search space: 1939963415
effective search space used: 1939963415
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)