BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020973
         (319 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XR2|A Chain A, Crystal Structure Of Oxidized T. Maritima Cobalamin-
           Independent Methionine Synthase Complexed With
           Methyltetrahydrofolate
 pdb|1XR2|B Chain B, Crystal Structure Of Oxidized T. Maritima Cobalamin-
           Independent Methionine Synthase Complexed With
           Methyltetrahydrofolate
          Length = 766

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 70  QCTTIHKSESSKRGEDISREKYSHWRQEQKTRAVSLEKQLN---------SRWELEELIK 120
           Q   + K  S  R  +IS+E+Y  + +EQ  +A+ L++++           R ++ E   
Sbjct: 446 QTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERTDMVEFFA 505

Query: 121 EQLNRFNTHYN 131
           E+LN   T  N
Sbjct: 506 EKLNGIATTQN 516


>pdb|1T7L|A Chain A, Crystal Structure Of Cobalamin-Independent Methionine
           Synthase From T. Maritima
 pdb|1T7L|B Chain B, Crystal Structure Of Cobalamin-Independent Methionine
           Synthase From T. Maritima
 pdb|3BQ5|A Chain A, Crystal Structure Of T. Maritima Cobalamin-Independent
           Methionine Synthase Complexed With Zn2+ And Homocysteine
           (Monoclinic)
 pdb|3BQ5|B Chain B, Crystal Structure Of T. Maritima Cobalamin-Independent
           Methionine Synthase Complexed With Zn2+ And Homocysteine
           (Monoclinic)
 pdb|3BQ6|A Chain A, Crystal Structure Of T. Maritima Cobalamin-Independent
           Methionine Synthase Complexed With Zn2+ (Monoclinic)
 pdb|3BQ6|B Chain B, Crystal Structure Of T. Maritima Cobalamin-Independent
           Methionine Synthase Complexed With Zn2+ (Monoclinic)
          Length = 766

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 70  QCTTIHKSESSKRGEDISREKYSHWRQEQKTRAVSLEKQLN---------SRWELEELIK 120
           Q   + K  S  R  +IS+E+Y  + +EQ  +A+ L++++           R ++ E   
Sbjct: 446 QTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERTDMVEFFA 505

Query: 121 EQLNRFNTHYN 131
           E+LN   T  N
Sbjct: 506 EKLNGIATTQN 516


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,866,128
Number of Sequences: 62578
Number of extensions: 222652
Number of successful extensions: 510
Number of sequences better than 100.0: 20
Number of HSP's better than 100.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 492
Number of HSP's gapped (non-prelim): 20
length of query: 319
length of database: 14,973,337
effective HSP length: 99
effective length of query: 220
effective length of database: 8,778,115
effective search space: 1931185300
effective search space used: 1931185300
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)