BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020976
         (319 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SPA|A Chain A, Crystal Structure Of Human Mitochondrial Rna Polymerase
          Length = 1134

 Score = 28.9 bits (63), Expect = 4.0,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 45  LVTYNILIKGLCKAGRLRTARWILKELGDSGHAPNAITYTTIMKCCFRNRKYKLGLE-IL 103
           L  YN ++ G  + G  +   ++L  + D+G  P+ ++Y   ++C  R  +    +E  L
Sbjct: 165 LDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCL 224

Query: 104 SAMKRKG 110
             M ++G
Sbjct: 225 EQMSQEG 231


>pdb|2YFW|B Chain B, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4
 pdb|2YFW|D Chain D, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4
 pdb|2YFW|F Chain F, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4
 pdb|2YFW|H Chain H, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4
          Length = 103

 Score = 28.5 bits (62), Expect = 5.8,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    L+++ A+KR+G T  GFG
Sbjct: 69  DAVTYTEHAK-----RKTVTSLDVVYALKRQGRTLYGFG 102


>pdb|3AZK|B Chain B, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k59q Mutation
 pdb|3AZK|F Chain F, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k59q Mutation
          Length = 106

 Score = 28.1 bits (61), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 72  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 105


>pdb|3AZJ|B Chain B, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k44q Mutation
 pdb|3AZJ|F Chain F, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k44q Mutation
          Length = 106

 Score = 28.1 bits (61), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 72  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 105


>pdb|3AZI|B Chain B, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k31q Mutation
 pdb|3AZI|F Chain F, Crystal Structure Of Human Nucleosome Core Particle
           Containing H4k31q Mutation
          Length = 106

 Score = 28.1 bits (61), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 72  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 105


>pdb|1HIO|D Chain D, Histone Octamer (Chicken), Chromosomal Protein, Alpha
           Carbons Only
          Length = 76

 Score = 28.1 bits (61), Expect = 7.6,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 42  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 75


>pdb|3C1B|B Chain B, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 pdb|3C1B|F Chain F, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
          Length = 102

 Score = 27.7 bits (60), Expect = 7.8,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 68  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 101


>pdb|1P3I|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3I|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
          Length = 102

 Score = 27.7 bits (60), Expect = 8.0,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 68  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 101


>pdb|1P3G|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3G|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
          Length = 102

 Score = 27.7 bits (60), Expect = 8.0,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 68  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 101


>pdb|1P3B|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3B|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
          Length = 102

 Score = 27.7 bits (60), Expect = 8.0,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 68  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 101


>pdb|1KX3|B Chain B, X-Ray Structure Of The Nucleosome Core Particle, Ncp146,
           At 2.0 A Resolution
 pdb|1KX3|F Chain F, X-Ray Structure Of The Nucleosome Core Particle, Ncp146,
           At 2.0 A Resolution
 pdb|1KX4|B Chain B, X-Ray Structure Of The Nucleosome Core Particle, Ncp146b,
           At 2.6 A Resolution
 pdb|1KX4|F Chain F, X-Ray Structure Of The Nucleosome Core Particle, Ncp146b,
           At 2.6 A Resolution
 pdb|1KX5|B Chain B, X-ray Structure Of The Nucleosome Core Particle, Ncp147,
           At 1.9 A Resolution
 pdb|1KX5|F Chain F, X-ray Structure Of The Nucleosome Core Particle, Ncp147,
           At 1.9 A Resolution
 pdb|1M18|B Chain B, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1M18|F Chain F, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1M19|B Chain B, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1M19|F Chain F, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1M1A|B Chain B, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1M1A|F Chain F, Ligand Binding Alters The Structure And Dynamics Of
           Nucleosomal Dna
 pdb|1P34|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P34|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3A|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3A|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3K|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3K|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3L|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3L|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3M|B Chain B, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1P3M|F Chain F, Crystallographic Studies Of Nucleosome Core Particles
           Containing Histone 'sin' Mutants
 pdb|1S32|B Chain B, Molecular Recognition Of The Nucleosomal 'supergroove'
 pdb|1S32|F Chain F, Molecular Recognition Of The Nucleosomal 'supergroove'
 pdb|1ZBB|B Chain B, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|F Chain F, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|BB Chain b, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZBB|FF Chain f, Structure Of The 4_601_167 Tetranucleosome
 pdb|1ZLA|B Chain B, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana
           Peptide Bound To The Nucleosomal Core
 pdb|1ZLA|F Chain F, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana
           Peptide Bound To The Nucleosomal Core
 pdb|2FJ7|B Chain B, Crystal Structure Of Nucleosome Core Particle Containing A
           Poly (Da.Dt) Sequence Element
 pdb|2FJ7|F Chain F, Crystal Structure Of Nucleosome Core Particle Containing A
           Poly (Da.Dt) Sequence Element
 pdb|2IO5|C Chain C, Crystal Structure Of The Cia- Histone H3-H4 Complex
 pdb|2NZD|B Chain B, Nucleosome Core Particle Containing 145 Bp Of Dna
 pdb|2NZD|F Chain F, Nucleosome Core Particle Containing 145 Bp Of Dna
 pdb|3B6F|B Chain B, Nucleosome Core Particle Treated With Cisplatin
 pdb|3B6F|F Chain F, Nucleosome Core Particle Treated With Cisplatin
 pdb|3B6G|B Chain B, Nucleosome Core Particle Treated With Oxaliplatin
 pdb|3B6G|F Chain F, Nucleosome Core Particle Treated With Oxaliplatin
 pdb|3C1C|B Chain B, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 pdb|3C1C|F Chain F, The Effect Of H3 K79 Dimethylation And H4 K20
           Trimethylation On Nucleosome And Chromatin Structure
 pdb|3C9K|D Chain D, Model Of Histone Octamer Tubular Crystals
 pdb|3C9K|H Chain H, Model Of Histone Octamer Tubular Crystals
 pdb|3KUY|B Chain B, Dna Stretching In The Nucleosome Facilitates Alkylation By
           An Intercalating Antitumor Agent
 pdb|3KUY|F Chain F, Dna Stretching In The Nucleosome Facilitates Alkylation By
           An Intercalating Antitumor Agent
 pdb|3LJA|B Chain B, Using Soft X-Rays For A Detailed Picture Of Divalent Metal
           Binding In The Nucleosome
 pdb|3LJA|F Chain F, Using Soft X-Rays For A Detailed Picture Of Divalent Metal
           Binding In The Nucleosome
 pdb|3LEL|B Chain B, Structural Insight Into The Sequence-Dependence Of
           Nucleosom Positioning
 pdb|3LEL|F Chain F, Structural Insight Into The Sequence-Dependence Of
           Nucleosom Positioning
 pdb|3LEL|L Chain L, Structural Insight Into The Sequence-Dependence Of
           Nucleosom Positioning
 pdb|3LEL|P Chain P, Structural Insight Into The Sequence-Dependence Of
           Nucleosom Positioning
 pdb|3MGP|B Chain B, Binding Of Cobalt Ions To The Nucleosome Core Particle
 pdb|3MGP|F Chain F, Binding Of Cobalt Ions To The Nucleosome Core Particle
 pdb|3MGQ|B Chain B, Binding Of Nickel Ions To The Nucleosome Core Particle
 pdb|3MGQ|F Chain F, Binding Of Nickel Ions To The Nucleosome Core Particle
 pdb|3MGR|B Chain B, Binding Of Rubidium Ions To The Nucleosome Core Particle
 pdb|3MGR|F Chain F, Binding Of Rubidium Ions To The Nucleosome Core Particle
 pdb|3MGS|B Chain B, Binding Of Cesium Ions To The Nucleosome Core Particle
 pdb|3MGS|F Chain F, Binding Of Cesium Ions To The Nucleosome Core Particle
 pdb|3KXB|B Chain B, Structural Characterization Of H3k56q Nucleosomes And
           Nucleosomal Arrays
 pdb|3KXB|F Chain F, Structural Characterization Of H3k56q Nucleosomes And
           Nucleosomal Arrays
 pdb|3MVD|B Chain B, Crystal Structure Of The Chromatin Factor Rcc1 In Complex
           With The Nucleosome Core Particle
 pdb|3MVD|F Chain F, Crystal Structure Of The Chromatin Factor Rcc1 In Complex
           With The Nucleosome Core Particle
 pdb|3LZ0|B Chain B, Crystal Structure Of Nucleosome Core Particle Composed Of
           The Widom 601 Dna Sequence (Orientation 1)
 pdb|3LZ0|F Chain F, Crystal Structure Of Nucleosome Core Particle Composed Of
           The Widom 601 Dna Sequence (Orientation 1)
 pdb|3LZ1|B Chain B, Crystal Structure Of Nucleosome Core Particle Composed Of
           The Widom 601 Dna Sequence (Orientation 2)
 pdb|3LZ1|F Chain F, Crystal Structure Of Nucleosome Core Particle Composed Of
           The Widom 601 Dna Sequence (Orientation 2)
 pdb|3O62|B Chain B, Nucleosome Core Particle Modified With A Cisplatin
           1,3-Cis-{pt(Nh3) 2}2+-D(Gptpg) Intrastrand Cross-Link
 pdb|3O62|F Chain F, Nucleosome Core Particle Modified With A Cisplatin
           1,3-Cis-{pt(Nh3) 2}2+-D(Gptpg) Intrastrand Cross-Link
 pdb|3MNN|B Chain B, A Ruthenium Antitumour Agent Forms Specific Histone
           Protein Adducts In The Nucleosome Core
 pdb|3MNN|F Chain F, A Ruthenium Antitumour Agent Forms Specific Histone
           Protein Adducts In The Nucleosome Core
 pdb|3TU4|B Chain B, Crystal Structure Of The Sir3 Bah Domain In Complex With A
           Nucleosome Core Particle.
 pdb|3TU4|F Chain F, Crystal Structure Of The Sir3 Bah Domain In Complex With A
           Nucleosome Core Particle.
 pdb|3REH|B Chain B, 2.5 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145)
 pdb|3REH|F Chain F, 2.5 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145)
 pdb|3REI|B Chain B, 2.65 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 pdb|3REI|F Chain F, 2.65 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 145 Bp Alpha-Satellite Dna
           (Ncp145) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 pdb|3REJ|B Chain B, 2.55 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b)
 pdb|3REJ|F Chain F, 2.55 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b)
 pdb|3REK|B Chain B, 2.6 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Oxaliplatin
 pdb|3REK|F Chain F, 2.6 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Oxaliplatin
 pdb|3REL|B Chain B, 2.7 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 pdb|3REL|F Chain F, 2.7 Angstrom Crystal Structure Of The Nucleosome Core
           Particle Assembled With A 146 Bp Alpha-Satellite Dna
           (Ncp146b) Derivatized With Triamminechloroplatinum(Ii)
           Chloride
 pdb|3UT9|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled
           With A Palindromic Widom '601' Derivative (Ncp-601l)
 pdb|3UT9|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled
           With A Palindromic Widom '601' Derivative (Ncp-601l)
 pdb|3UTA|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled
           With An Alpha- Satellite Sequence Containing Two Ttaaa
           Elements (Ncp-Ta2)
 pdb|3UTA|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled
           With An Alpha- Satellite Sequence Containing Two Ttaaa
           Elements (Ncp-Ta2)
 pdb|3UTB|B Chain B, Crystal Structure Of Nucleosome Core Particle Assembled
           With The 146b Alpha-Satellite Sequence (Ncp146b)
 pdb|3UTB|F Chain F, Crystal Structure Of Nucleosome Core Particle Assembled
           With The 146b Alpha-Satellite Sequence (Ncp146b)
 pdb|4H9N|B Chain B, Complex Structure 1 Of DaxxH3.3(SUB5)H4
 pdb|4H9O|B Chain B, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4
 pdb|4H9P|B Chain B, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4
 pdb|4H9Q|B Chain B, Complex Structure 4 Of Daxx(E225a)H3.3(SUB5)H4
 pdb|4H9R|B Chain B, Complex Structure 5 Of Daxx(E225a)H3.3(SUB5,G90A)H4
          Length = 102

 Score = 27.7 bits (60), Expect = 8.4,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +A+TYT   K     RK    ++++ A+KR+G T  GFG
Sbjct: 68  DAVTYTEHAK-----RKTVTAMDVVYALKRQGRTLYGFG 101


>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific
           Histone H3 Variant By Nonhistone Scm3
          Length = 235

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 5/39 (12%)

Query: 79  NAITYTTIMKCCFRNRKYKLGLEILSAMKRKGYTFDGFG 117
           +++TYT   K     RK    L+++ A+KR+G T  GFG
Sbjct: 201 DSVTYTEHAK-----RKTVTSLDVVYALKRQGRTLYGFG 234


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.139    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,791,614
Number of Sequences: 62578
Number of extensions: 345871
Number of successful extensions: 1042
Number of sequences better than 100.0: 25
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 24
Number of HSP's that attempted gapping in prelim test: 1041
Number of HSP's gapped (non-prelim): 25
length of query: 319
length of database: 14,973,337
effective HSP length: 99
effective length of query: 220
effective length of database: 8,778,115
effective search space: 1931185300
effective search space used: 1931185300
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 51 (24.3 bits)