BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 020999
         (318 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2P6Y|A Chain A, X-Ray Structure Of The Protein Q9km02_vibch From Vibrio
           Cholerae At The Resolution 1.63 A. Northeast Structural
           Genomics Consortium Target Vcr80
          Length = 142

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 137 HIITVNT--GEDVTMKIISFSQQGP-RAICILSANGVISSVTLRQPDSSGGTLTYEGRFE 193
           H+I +    G D+  +I+   QQ    A  I S  G +S++ +R  DS   TL     FE
Sbjct: 3   HLIALRLTRGXDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVS-TLQVSAPFE 61

Query: 194 ILSLSGSF 201
           ILSLSG+ 
Sbjct: 62  ILSLSGTL 69


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.129    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,714,177
Number of Sequences: 62578
Number of extensions: 163933
Number of successful extensions: 289
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 289
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 14,973,337
effective HSP length: 99
effective length of query: 219
effective length of database: 8,778,115
effective search space: 1922407185
effective search space used: 1922407185
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 51 (24.3 bits)