Citrus Sinensis ID: 021020

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MGWGIAIYEGTVVTGSLILLGWAGLWFLNIRLYKEYEEKRALVQIIFSVVFAFSCNLLQLVLFEIIPILSKEARVVNWKVDLFCLILLLVFMLPYYHCYLMLCNSGVRKERAALGAILFLLAFLYAFWRMGIHFPMPSPEKGFFTIPQLVSRIGVIGVTVMAVLAGFGAVNLPYSYLSLFIREIDESEIKALERQLMQSIETCIAKKKKIILCQMEMDRIQGSEEKLKARSFFKRIVGTVVRSVQDDQKEQDIKIMEAEVQALEELSKQLFLEIYELRQAKEAAAYSRTWRGHMQNLLGYALSIYCVYKMIKVWLSFF
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccCEcccHHEEEEEHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*GWGIAIYEGTVVTGSLILLGWAGLWFLNIRLYKEYEEKRALVQIIFSVVFAFSCNLLQLVLFEIIPILSKEARVVNWKVDLFCLILLLVFMLPYYHCYLMLCNSGVRKERAALGAILFLLAFLYAFWRMGIHFPMPSPEKGFFTIPQLVSRIGVIGVTVMAVLAGFGAVNLPYSYLSLFIREIDESEIKALERQLMQSIETCIAKKKKIILCQMEMDRIQG******************************IKIMEAEVQALEELSKQLFLEIYELRQAKEAAAYSRTWRGHMQNLLGYALSIYCVYKMIKVWLSFF
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWGIAIYEGTVVTGSLILLGWAGLWFLNIRLYKEYEEKRALVQIIFSVVFAFSCNLLQLVLFEIIPILSKEARVVNWKVDLFCLILLLVFMLPYYHCYLMLCNSGVRKERAALGAILFLLAFLYAFWRMGIHFPMPSPEKGFFTIPQLVSRIGVIGVTVMAVLAGFGAVNLPYSYLSLFIxxxxxxxxxxxxxxxxxxxxxCIAKKKKIILCQMEMDRIQGSEEKLKARSFFKRIVGTVVRSVQxxxxxxxxxxxxxxxxxxxxxxxxxxxxIYELRQAKEAAAYSRTWRGHMQNLLGYALSIYCVYKMIKVWLSFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GPCR-type G protein 2 Abscisic acid receptor. The GDP-bound form exhibits greater abscisic acid binding than the GTP-bound form.probableQ0WQG8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZN, chain A
Confidence level:probable
Coverage over the Query: 273-279
View the alignment between query and template
View the model in PyMOL