Citrus Sinensis ID: 021034


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MATLAQQFTGLRCPPISHTRLSRRKSITQIQQKLLNSRKNKTIVSAVAISNAETREREELNQLFEEAYERCRTAPMEGVSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCRQLQSEDVVVKGKVVGANKGGVVAEVEGLRGFVPFSQISSKSTAEELLGKDLPLKFVEVDEEQSRLVLSNRKAMADSQAQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVCL
ccHHHHHHHcccccccccccccccccHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccEEEEEEEEECccEEEEEcccccEEEEEcHHHcccccccccccccccccEEEEEEEEEEcccccEEEEHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEccCEEEEcccccccccccccccccEEEEEEEEECcccccEEEEEHHHHHHHHHccccccEEEEEEEEEcccCEEEEccccccHHHHHHHccccccccccccccccEEEEEc
********T*********************************IVSAVAISNAETREREELNQLFEEAYERCRTAPMEGVSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCRQLQSEDVVVKGKVVGANKGGVVAEVEGLRGFVPFSQISSKSTAEELLGKDLPLKFVEVDEEQSRLVLSNRKAMADSQAQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVCL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLAQQFTGLRCPPISHTRLSRRKSITQIQQKLLNSRKNKTIVSAVAIxxxxxxxxxxxxxxxxxxxxxCRTAPMEGVSFTLEEFHSALEKYDFNSELGTKVKGTVFCTDNRGALVDITAKSSAYLPTQEACIHKIKHVEEAGIVPGLKEEFVIIGENEADDSLVLSLRMIQYELAWERCRQLQSEDVVVKGKVVGANKGGVVAEVEGLRGFVPFSQISSKSTAEELLGKDLPLKFVEVDEEQSRLVLSNRKAMADSQAQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S1, chloroplastic Actively engaged in the initiation complex formation via a strong mRNA-binding activity. Possesses a poly(A)-binding activity which might play a role as a control element in chloroplast mRNA translation.probableP29344

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GO5, chain A
Confidence level:very confident
Coverage over the Query: 98-134,146-173,185-318
View the alignment between query and template
View the model in PyMOL
Template: 3GO5, chain A
Confidence level:very confident
Coverage over the Query: 96-254
View the alignment between query and template
View the model in PyMOL
Template: 4AID, chain A
Confidence level:very confident
Coverage over the Query: 65-89
View the alignment between query and template
View the model in PyMOL