Citrus Sinensis ID: 021038
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| 224092372 | 300 | predicted protein [Populus trichocarpa] | 0.858 | 0.91 | 0.813 | 1e-130 | |
| 356563813 | 308 | PREDICTED: RING finger and CHY zinc fing | 0.968 | 1.0 | 0.724 | 1e-128 | |
| 225430120 | 315 | PREDICTED: RING finger and CHY zinc fing | 0.974 | 0.984 | 0.723 | 1e-128 | |
| 356552549 | 308 | PREDICTED: RING finger and CHY zinc fing | 0.968 | 1.0 | 0.733 | 1e-128 | |
| 296081945 | 294 | unnamed protein product [Vitis vinifera] | 0.864 | 0.935 | 0.794 | 1e-127 | |
| 356515508 | 309 | PREDICTED: RING finger and CHY zinc fing | 0.959 | 0.987 | 0.707 | 1e-125 | |
| 356552551 | 323 | PREDICTED: RING finger and CHY zinc fing | 0.968 | 0.953 | 0.699 | 1e-125 | |
| 255635979 | 309 | unknown [Glycine max] | 0.959 | 0.987 | 0.703 | 1e-124 | |
| 449437104 | 307 | PREDICTED: RING finger and CHY zinc fing | 0.933 | 0.967 | 0.711 | 1e-123 | |
| 297808579 | 308 | zinc finger family protein [Arabidopsis | 0.861 | 0.889 | 0.759 | 1e-121 |
| >gi|224092372|ref|XP_002309580.1| predicted protein [Populus trichocarpa] gi|118485648|gb|ABK94674.1| unknown [Populus trichocarpa] gi|222855556|gb|EEE93103.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 471 bits (1212), Expect = e-130, Method: Compositional matrix adjust.
Identities = 223/274 (81%), Positives = 247/274 (90%), Gaps = 1/274 (0%)
Query: 45 DREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNI 104
+ +F+ +EES N + ++L KG MEYGC HYRRRCRIRAPCCNE+FDCRHCHNEA NNI
Sbjct: 28 NEDFIFSEESMNVE-TPQILDKGLMEYGCLHYRRRCRIRAPCCNEVFDCRHCHNEAKNNI 86
Query: 105 NVDQKLRHDIPRHEVNQVICSLCGTEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQY 164
NVDQK RHD+PRHEV QVICSLCGTEQ+VQQVC+NCGVCMG+YFCE+CKLFDDDTSKKQY
Sbjct: 87 NVDQKHRHDMPRHEVKQVICSLCGTEQEVQQVCINCGVCMGKYFCETCKLFDDDTSKKQY 146
Query: 165 HCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVI 224
HCDGCGICRIGG +NFFHC KC CCYS LLKNSHPCVEGAMHHDCPVC E+LFE+R DV
Sbjct: 147 HCDGCGICRIGGPENFFHCYKCGCCYSNLLKNSHPCVEGAMHHDCPVCFEFLFESRYDVT 206
Query: 225 VLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVW 284
VLPCGHTIH++CLKEMR+H+QYACP+CSKSVCDMSKVWEK+D EIAATPMPE YLNK VW
Sbjct: 207 VLPCGHTIHESCLKEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPYLNKMVW 266
Query: 285 ILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 318
ILCNDCGK+S VQFHV+AQKC NCKSYNTR TR
Sbjct: 267 ILCNDCGKSSEVQFHVVAQKCMNCKSYNTRQTRS 300
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356563813|ref|XP_003550153.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225430120|ref|XP_002284652.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|147785653|emb|CAN68688.1| hypothetical protein VITISV_029477 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552549|ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296081945|emb|CBI20950.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356515508|ref|XP_003526442.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356552551|ref|XP_003544630.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255635979|gb|ACU18335.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449437104|ref|XP_004136332.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] gi|449505475|ref|XP_004162482.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297808579|ref|XP_002872173.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318010|gb|EFH48432.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| TAIR|locus:2172656 | 291 | AT5G22920 [Arabidopsis thalian | 0.836 | 0.914 | 0.602 | 1.9e-99 | |
| TAIR|locus:2179474 | 328 | AT5G25560 [Arabidopsis thalian | 0.842 | 0.817 | 0.635 | 1e-98 | |
| TAIR|locus:2180074 | 267 | MIEL1 "MYB30-Interacting E3 Li | 0.783 | 0.932 | 0.555 | 9.1e-84 | |
| TAIR|locus:2099212 | 287 | AT3G62970 [Arabidopsis thalian | 0.773 | 0.857 | 0.524 | 1e-75 | |
| UNIPROTKB|Q96PM5 | 261 | RCHY1 "RING finger and CHY zin | 0.738 | 0.900 | 0.429 | 1.2e-56 | |
| UNIPROTKB|J9NZR5 | 259 | RCHY1 "Uncharacterized protein | 0.723 | 0.888 | 0.433 | 1.6e-56 | |
| UNIPROTKB|A4IFE2 | 261 | RCHY1 "RCHY1 protein" [Bos tau | 0.723 | 0.881 | 0.433 | 2e-56 | |
| RGD|1359180 | 261 | Rchy1 "ring finger and CHY zin | 0.738 | 0.900 | 0.425 | 3.3e-56 | |
| MGI|MGI:1915348 | 261 | Rchy1 "ring finger and CHY zin | 0.738 | 0.900 | 0.421 | 1.1e-55 | |
| ZFIN|ZDB-GENE-040801-73 | 264 | rchy1 "ring finger and CHY zin | 0.726 | 0.875 | 0.425 | 1.4e-55 |
| TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 987 (352.5 bits), Expect = 1.9e-99, P = 1.9e-99
Identities = 161/267 (60%), Positives = 202/267 (75%)
Query: 53 ESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRH 112
E+ + L+ G YGC HYRRRC+IRAPCC+EIFDCRHCHNEA ++++++Q RH
Sbjct: 7 ENEQNQEFANLMEIGSGHYGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKDSLHIEQHHRH 66
Query: 113 DIPRHEVNQVICSLCGTEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHXXXXXXX 172
++PRHEV++VICSLC TEQ VQQ C NCGVCMG+YFC CK FDDD SKKQYH
Sbjct: 67 ELPRHEVSKVICSLCETEQDVQQNCSNCGVCMGKYFCSKCKFFDDDLSKKQYHCDECGIC 126
Query: 173 XXXXXXNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTI 232
NFFHC +CRCCYS ++++ H CVEGAMHH+CPVC EYLF++ +D+ VL CGHT+
Sbjct: 127 RTGGEENFFHCKRCRCCYSKIMEDKHQCVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTM 186
Query: 233 HKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGK 292
H C K+M H++Y CP+CSKS+CDMS +W+K D E+AA PMP+ Y NK VWILCNDCG
Sbjct: 187 HLECTKDMGLHNRYTCPVCSKSICDMSNLWKKLDEEVAAYPMPKMYENKMVWILCNDCGS 246
Query: 293 TSNVQFHVLAQKCPNCKSYNTRLT-RG 318
+NV+FH++A KC +C SYNTR T RG
Sbjct: 247 NTNVRFHLIAHKCSSCGSYNTRQTQRG 273
|
|
| TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96PM5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZR5 RCHY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4IFE2 RCHY1 "RCHY1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915348 Rchy1 "ring finger and CHY zinc finger domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| pfam05495 | 74 | pfam05495, zf-CHY, CHY zinc finger | 3e-18 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 8e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 9e-05 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 9e-05 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 3e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.002 |
| >gnl|CDD|218608 pfam05495, zf-CHY, CHY zinc finger | Back alignment and domain information |
|---|
Score = 77.0 bits (190), Expect = 3e-18
Identities = 38/85 (44%), Positives = 49/85 (57%), Gaps = 12/85 (14%)
Query: 73 CQHYRRR-CRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSLCGTEQ 131
C+HY R C IRAPCCN+ + CR CH+E + H + R V V+C +C TEQ
Sbjct: 1 CKHYHRNLCAIRAPCCNKYYPCRLCHDELED---------HPLDRWNVKAVLCGVCRTEQ 51
Query: 132 KVQQVCVNCGVCMGEYFCESCKLFD 156
VQ+ NCGV +Y+C CKLF
Sbjct: 52 TVQE--YNCGVEFADYYCPICKLFF 74
|
This family of domains are likely to bind to zinc ions. They contain many conserved cysteine and histidine residues. We have named this domain after the N-terminal motif CXHY. This domain can be found in isolation in some proteins, but is also often associated with pfam00097. One of the proteins in this family is a mitochondrial intermembrane space protein called Hot13. This protein is involved in the assembly of small TIM complexes. Length = 74 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 100.0 | |
| PF14599 | 61 | zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. | 99.93 | |
| PF05495 | 71 | zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc | 99.88 | |
| COG4357 | 105 | Zinc finger domain containing protein (CHY type) [ | 99.35 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.26 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.11 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.93 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.91 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.87 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.78 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.7 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.69 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.67 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.65 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.63 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.58 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.57 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.55 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.51 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.51 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.45 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.41 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.37 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.24 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.12 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.03 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.9 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.77 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.77 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.73 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.72 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.72 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.7 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.56 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.49 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.49 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.44 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.38 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.37 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.23 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 96.94 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.92 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.77 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.55 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 96.55 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.36 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.36 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.36 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.27 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 96.21 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.1 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.98 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 95.9 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 95.8 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.22 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.87 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 94.81 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 94.73 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.71 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.65 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 94.3 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 94.26 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 94.23 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.93 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.07 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 92.73 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.69 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.58 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 92.57 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 92.57 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 92.2 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.8 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 91.78 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.53 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.45 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 91.36 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.99 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 90.79 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 90.78 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.72 | |
| TIGR00100 | 115 | hypA hydrogenase nickel insertion protein HypA. In | 90.7 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 90.66 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.59 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.19 | |
| PRK00564 | 117 | hypA hydrogenase nickel incorporation protein; Pro | 89.67 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 89.27 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 88.81 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 88.62 | |
| PHA02862 | 156 | 5L protein; Provisional | 88.52 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.38 | |
| PRK12380 | 113 | hydrogenase nickel incorporation protein HybF; Pro | 88.36 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 87.99 | |
| PRK03681 | 114 | hypA hydrogenase nickel incorporation protein; Val | 87.97 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 87.91 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 87.48 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 86.91 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 85.99 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 85.98 | |
| PF01155 | 113 | HypA: Hydrogenase expression/synthesis hypA family | 85.85 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 85.76 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 85.37 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 85.35 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.77 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 84.69 | |
| PRK00762 | 124 | hypA hydrogenase nickel incorporation protein; Pro | 83.06 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 81.36 | |
| COG0375 | 115 | HybF Zn finger protein HypA/HybF (possibly regulat | 81.04 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 80.07 |
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-67 Score=492.39 Aligned_cols=249 Identities=51% Similarity=1.047 Sum_probs=241.0
Q ss_pred cCCCchhhccCCCccCCccccccceeEcCCCCCeecCcchHhhhhcCCCcCccCCCCCCCccCceeecCCCCcccccccc
Q 021038 57 HNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSLCGTEQKVQQV 136 (318)
Q Consensus 57 ~~~~~~~~~~~~~~~gC~HY~R~c~i~~pCC~~~y~Cr~CHde~~~~~~~~~~~~H~ldR~~v~~v~C~~C~~eQ~v~~~ 136 (318)
+..+.+++|++.+++||+||+|++++++|+|++||+||+||+++. +|+++|+.|.+|+|+.|.++|+++++
T Consensus 19 ~~~~~~~~d~~~~~~~c~hy~r~~~~~a~ccd~~~~C~hCH~~s~---------~h~~~r~~v~~~~C~~C~~~q~~~~~ 89 (276)
T KOG1940|consen 19 SSIHSDAEDEIAFPYGCPHYRRNCKSRAPCCDREITCRHCHNESE---------DHDLDRKTVYELLCMKCRKIQPVGQI 89 (276)
T ss_pred hhcccccccccccccCCchhhhccccccccccceeeeEEecChhh---------hcccchhhhhhhhhhhHHhhhhhhhc
Confidence 333457889999999999999999999999999999999999975 89999999999999999999999999
Q ss_pred CcCCCCccceEecCccccccCCCCCCeeecCCCCceeecCCcceeeccCccceeeccccccccccCCCCCCCCccccccc
Q 021038 137 CVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYL 216 (318)
Q Consensus 137 C~~Cg~~f~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~Cie~~~~~~CpIClE~l 216 (318)
|.+|+..||+|||.+|+||||+++ +||||++|||||+|++++||||++|+.|++..+.+.|+|+|++++.+||||.|+|
T Consensus 90 c~~c~~~~g~~~c~~C~l~dd~~~-~~~hC~~C~icr~g~~~~~fhc~~c~~c~~~~~~~~H~c~e~~~~~ncPic~e~l 168 (276)
T KOG1940|consen 90 CSNCHVELGEYYCLICKLFDDDPS-KQYHCDLCGICREGLGLDFFHCKKCKACLSAYLSNWHKCVERSSEFNCPICKEYL 168 (276)
T ss_pred cccchhhhhhhcCccccccccccc-ceeccccccccccccccchhHHhhhHhHHhhhcccccchhhhcccCCCchhHHHh
Confidence 999999999999999999999998 9999999999999999999999999999999999999999999999999999999
Q ss_pred ccCCceeEEcCCCCccchHHHHHHHhcCCCCCCCCCcccCchhHHHHHhHHHHHcCCCChhhhcCcceEEcCCCCCCccc
Q 021038 217 FETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNV 296 (318)
Q Consensus 217 f~s~~~v~~LpCGH~fH~~Cl~~wl~~~~~~CPiCrks~~d~~~~~~~lD~~i~~~pmPeey~~~~v~IlCnDC~~~s~v 296 (318)
|++...+..|+|||++|..|++++...+ |+||+|.+ +.||..+|+++|.+|+++|||++|.+++++|+||||+..+++
T Consensus 169 ~~s~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~~~~~~i~cndC~~~~~~ 246 (276)
T KOG1940|consen 169 FLSFEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYKNKTQDILCNDCGSGTNV 246 (276)
T ss_pred ccccccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhhchhheeeccCCCCCCcc
Confidence 9999999999999999999999998866 99999999 999999999999999999999999999999999999999999
Q ss_pred cceeeeccCCCCCCccccccC
Q 021038 297 QFHVLAQKCPNCKSYNTRLTR 317 (318)
Q Consensus 297 ~~H~lg~KC~~C~SyNT~~~~ 317 (318)
+||||++||+.|+|||||+++
T Consensus 247 k~~~l~~kc~~c~~~~~r~~~ 267 (276)
T KOG1940|consen 247 KYHILYHKCGKCGSYNTRMIS 267 (276)
T ss_pred ceehhhhhCCCcccceeeecc
Confidence 999999999999999999985
|
|
| >PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A | Back alignment and domain information |
|---|
| >PF05495 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00100 hypA hydrogenase nickel insertion protein HypA | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00564 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12380 hydrogenase nickel incorporation protein HybF; Provisional | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03681 hypA hydrogenase nickel incorporation protein; Validated | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PRK00762 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 318 | ||||
| 2k2c_A | 137 | Solution Nmr Structure Of N-Terminal Domain Of Huma | 1e-18 | ||
| 2dkt_A | 143 | Solution Structure Of The Chy Zinc Finger Domain Of | 2e-18 | ||
| 2k2d_A | 79 | Solution Nmr Structure Of C-Terminal Domain Of Huma | 3e-14 | ||
| 2ecm_A | 55 | Solution Structure Of The Ring Domain Of The Ring F | 1e-04 | ||
| 2jrj_A | 52 | Solution Structure Of The Human Pirh2 Ring-H2 Domai | 2e-04 |
| >pdb|2K2C|A Chain A, Solution Nmr Structure Of N-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2a Length = 137 | Back alignment and structure |
|
| >pdb|2DKT|A Chain A, Solution Structure Of The Chy Zinc Finger Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 143 | Back alignment and structure |
| >pdb|2K2D|A Chain A, Solution Nmr Structure Of C-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2c Length = 79 | Back alignment and structure |
| >pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 | Back alignment and structure |
| >pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| 2dkt_A | 143 | Ring finger and CHY zinc finger domain- containing | 2e-41 | |
| 2k2d_A | 79 | Ring finger and CHY zinc finger domain- containing | 4e-29 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 1e-14 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 2e-05 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 2e-05 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 3e-05 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 1e-04 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 8e-04 |
| >2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Length = 143 | Back alignment and structure |
|---|
Score = 140 bits (353), Expect = 2e-41
Identities = 57/138 (41%), Positives = 78/138 (56%), Gaps = 11/138 (7%)
Query: 69 MEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSLCG 128
GC+HY R C ++APCC++++ CR CH+ + H + R +V +V C C
Sbjct: 15 GPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNED---------HQLDRFKVKEVQCINCE 65
Query: 129 TEQKVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRC 188
Q QQ C +C GEY+C C LFD D K+QYHC+ CGICRIG ++FFHC KC
Sbjct: 66 KLQHAQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNL 123
Query: 189 CYSMLLKNSHPCVEGAMH 206
C + L+ H C+E
Sbjct: 124 CLTTNLRGKHKCIESGPS 141
|
| >2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| 2dkt_A | 143 | Ring finger and CHY zinc finger domain- containing | 100.0 | |
| 2k2d_A | 79 | Ring finger and CHY zinc finger domain- containing | 99.93 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.33 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.24 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.24 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.22 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.21 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.21 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.18 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.17 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.15 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.13 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.12 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.1 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.06 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.06 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.03 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.02 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.02 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.0 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.99 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.98 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.98 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.96 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.96 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.92 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.92 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.9 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.9 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.88 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.87 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.84 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.83 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.82 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.82 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.82 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.81 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.8 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.8 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.8 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.79 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.77 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.77 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.76 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.71 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.69 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.69 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.55 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.54 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.5 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.5 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.47 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.47 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.46 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.46 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.46 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.43 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.43 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.41 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.32 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.31 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.31 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.25 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.23 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.2 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.11 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.08 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.87 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.82 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.69 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.47 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.41 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.11 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 90.9 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 89.92 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 88.27 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 87.99 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 87.89 | |
| 3a43_A | 139 | HYPD, hydrogenase nickel incorporation protein HYP | 87.73 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 87.03 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 82.95 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 80.27 |
| >2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-54 Score=372.10 Aligned_cols=135 Identities=41% Similarity=1.022 Sum_probs=128.5
Q ss_pred hhhccCCCccCCccccccceeEcCCCCCeecCcchHhhhhcCCCcCccCCCCCCCccCceeecCCCCccccccccCcCCC
Q 021038 62 ELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVICSLCGTEQKVQQVCVNCG 141 (318)
Q Consensus 62 ~~~~~~~~~~gC~HY~R~c~i~~pCC~~~y~Cr~CHde~~~~~~~~~~~~H~ldR~~v~~v~C~~C~~eQ~v~~~C~~Cg 141 (318)
..+|++.+++||+||+|+|+|+||||++|||||+||||++ +|+++|+++++|+||+|+++|++++.|++||
T Consensus 8 ~~~~~~~~~~gC~HY~r~~~lr~pCC~k~y~Cr~CHde~~---------dH~l~r~~~~~vlCg~C~~~q~~~~~C~~Cg 78 (143)
T 2dkt_A 8 GVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNE---------DHQLDRFKVKEVQCINCEKLQHAQQTCEDCS 78 (143)
T ss_dssp CCCCCCCCSSSCSSCCCSEEEEETTTTEEESSHHHHHHTS---------SSCCCSSSCCCEEESSSCCEECSCSBCSSSC
T ss_pred cccccccCcCCCcccCCCeeEECCCCCCccchhhhhcccc---------ccccchhccceeeecccCccccccCcCCCCC
Confidence 4457788899999999999999999999999999999975 7999999999999999999999999999999
Q ss_pred CccceEecCccccccCCCCCCeeecCCCCceeecCCcceeeccCccceeeccccccccccCCCCCC
Q 021038 142 VCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHH 207 (318)
Q Consensus 142 ~~f~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~Cie~~~~~ 207 (318)
+.||+|||+|||||| ++|+||||++|||||+|+++|||||++||+|||++|+++|+|+|++++.
T Consensus 79 ~~f~~Y~C~~C~l~d--~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~s 142 (143)
T 2dkt_A 79 TLFGEYYCSICHLFD--KDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIESGPSS 142 (143)
T ss_dssp CBSCSEECSSSCCEE--CSSSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSCCCSCC
T ss_pred ccceeeEeceeeccc--CCCceecCCCCCceeccCCcCcEECCcCCeeeccccCcCcccCccCccC
Confidence 999999999999997 4699999999999999999999999999999999999999999998864
|
| >2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 318 | ||||
| d2dkta2 | 56 | g.93.1.1 (A:82-137) RING finger and CHY zinc finge | 2e-20 | |
| d2dkta1 | 74 | g.89.1.1 (A:8-81) RING finger and CHY zinc finger | 4e-12 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 9e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 7e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 0.001 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.004 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 0.004 |
| >d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
class: Small proteins fold: Zinc hairpin stack superfamily: Zinc hairpin stack family: Zinc hairpin stack domain: RING finger and CHY zinc finger domain-containing protein 1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 80.9 bits (200), Expect = 2e-20
Identities = 32/58 (55%), Positives = 40/58 (68%), Gaps = 2/58 (3%)
Query: 145 GEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVE 202
GEY+C C LFD D K+QYHC+ CGICRIG ++FFHC KC C + L+ H C+E
Sbjct: 1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56
|
| >d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| d2dkta2 | 56 | RING finger and CHY zinc finger domain-containing | 99.95 | |
| d2dkta1 | 74 | RING finger and CHY zinc finger domain-containing | 99.72 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.36 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.28 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.26 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.23 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.17 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.12 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.93 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.86 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.84 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.74 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.74 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.69 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.66 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.63 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.23 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.05 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 89.05 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 88.97 | |
| d2dkta2 | 56 | RING finger and CHY zinc finger domain-containing | 81.56 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 80.71 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 80.36 |
| >d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Zinc hairpin stack superfamily: Zinc hairpin stack family: Zinc hairpin stack domain: RING finger and CHY zinc finger domain-containing protein 1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95 E-value=1.4e-29 Score=183.67 Aligned_cols=56 Identities=57% Similarity=1.394 Sum_probs=54.1
Q ss_pred ceEecCccccccCCCCCCeeecCCCCceeecCCcceeeccCccceeeccccccccccC
Q 021038 145 GEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVE 202 (318)
Q Consensus 145 ~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~Cie 202 (318)
|+|||+|||||||| |+||||++|||||+|++++||||++||+||+++|+++|+|+|
T Consensus 1 G~YfC~iC~l~ddd--k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~~~~l~~~H~CiE 56 (56)
T d2dkta2 1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56 (56)
T ss_dssp CSEECSSSCCEECS--SSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSC
T ss_pred CceECCcCCcccCC--CCcccCCCCCceeecCCccccccCccccccCcccCCCccccC
Confidence 68999999999885 999999999999999999999999999999999999999997
|
| >d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|