Citrus Sinensis ID: 021066

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------

MEEQEQKLLKTLHYWGNTPEEEYYNQQGIRTTQSYHTSPRGLTLFTRSWLPINTPPRGILCMVHGYGNDISWTFQGISVFLAQMGFACFALDLEGHGKSQGLKAYVPNVDLVVQDCLSYFNSVKQDPSFNGLPCFLYGESMGGAICLLIHFADPNGFDGAILVAPMCKISDKVKPRWPIPQILSLIARFFPTLPIVPTQDLLSKSIKVEEKKIIADLNPHRYRGKPRLGTVVELLRVTDYLSERLYDVSIPFIVLHGNADVVTDPSVSEALYEEARSSDKTIKIYDGMLHSLLFGETDENIEIVRNDILSWLNGRCN

cHHHHHHHHHHccccccccccccccccccCEEEEEEEcccccEEEEEEEcccccccCEEEEEEcccccccccHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEECcHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEECcccccccHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHcc

************HYWGNTPEEEYYNQQGIRTTQSYHTSPRGLTLFTRSWLPINTPPRGILCMVHGYGNDISWTFQGISVFLAQMGFACFALDLEGHGKSQGLKAYVPNVDLVVQDCLSYFNSVKQDPSFNGLPCFLYGESMGGAICLLIHFADPNGFDGAILVAPMCKISDKVKPRWPIPQILSLIARFFPTLPIVPTQDLLSKSIKVEEKKIIADLNPHRYRGKPRLGTVVELLRVTDYLSERLYDVSIPFIVLHGNADVVTDPSVSEALYEEARSSDKTIKIYDGMLHSLLFGETDENIEIVRNDILSWLNGRC*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Monoglyceride lipase	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity). Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth.	probable	Q99685

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HJU, chain A
Confidence level:very confident
Coverage over the Query: 28-316
View the alignment between query and template
View the model in PyMOL