Citrus Sinensis ID: 021075


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MDSQQRKRKRQPGGLQKKGAPILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERMGNSGNSNSHSGDNEIVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
ccHHHHHHHcccccccccccccHHcccccccccccccccccccHHHHHHHHcccccccccHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcccHHHccccccccHHHHHHHHHcccccccEEEEccEEEccccccEEEEEccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccEEc
ccHHHHHHccccccccccccccHHccccccccccccEEEEEEccHHHEEEEEccccccEEEEccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHccccHHccccccccHHHHHHHHHHccccccEEEEccEEEEccHHHHHHHccccccccEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHccHEccHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHEHHHHHHcccccEEc
mdsqqrkrkrqpgglqkkgapilrangqdavptsstygfvSYFNEEVKRLRSENSDLSVTLGLRKHIGktykelppeqkARYKkrdermgnsgnsnshsgdneivetkcvpERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKimgvkdggmaikingasdHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCpigsyistlflhpimdvssikslnwaTFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
mdsqqrkrkrqpgglqkkgapilrangqdavptsstYGFVSYFNEEVKRlrsensdlsvTLGLrkhigktykelppeqkarykkrdermgnsgnsnshsgdneivETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQlklsicll
MDSQQRKRKRQPGGLQKKGAPILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERMgnsgnsnshsgdnEIVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
***********************************TYGFVSYFNEEVK**********VTLGLRKHI************************************IVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICL*
**************************************F*****************************************************************VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
****************KKGAPILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKA*********************NEIVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
****************************DAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRK****************************************ETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSQQRKRKRQPGGLQKKGAPILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERMGNSGNSNSHSGDNEIVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIRIRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSYISTLFLHPIMDVSSIKSLNWATFCYDWLVKSICRFQNQQAAYIGGCLHFLQVRPLLQLKLSICLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
296087190 766 unnamed protein product [Vitis vinifera] 0.826 0.342 0.337 8e-35
225453104 617 PREDICTED: uncharacterized protein LOC10 0.753 0.387 0.341 4e-34
147783848 708 hypothetical protein VITISV_032233 [Viti 0.753 0.337 0.341 6e-34
255583781 421 conserved hypothetical protein [Ricinus 0.835 0.629 0.308 1e-32
147795729 849 hypothetical protein VITISV_004916 [Viti 0.905 0.338 0.289 7e-32
224077245 628 predicted protein [Populus trichocarpa] 0.832 0.420 0.307 5e-30
147772140 637 hypothetical protein VITISV_026046 [Viti 0.785 0.390 0.292 8e-30
356533899 590 PREDICTED: uncharacterized protein LOC10 0.779 0.418 0.274 2e-23
147798273326 hypothetical protein VITISV_001668 [Viti 0.684 0.665 0.302 1e-21
147856790 479 hypothetical protein VITISV_019328 [Viti 0.744 0.492 0.259 3e-21
>gi|296087190|emb|CBI33564.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  153 bits (387), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 140/270 (51%), Gaps = 8/270 (2%)

Query: 42  YFNEEVKRLRSENSDLSVTL-GLRKHIGKTYKELPPEQKARYKKR-----DERMGNSGNS 95
           YF+ E  R  S +   S  L    K     +K +  E+KA+Y KR     D  +  +   
Sbjct: 169 YFSREFIREYSASHPESSGLKAATKAASDAWKSMSLEEKAKYTKRSREVWDNYLTTAPAR 228

Query: 96  NSHSGDNEIVETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVN 155
                    + T+C P R   +++ L+ ++K A+R +GF SLL LRC  L+R LC WL+ 
Sbjct: 229 APKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVRSMGFGSLLGLRCRTLRRSLCLWLLE 288

Query: 156 QFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAEVRRIFQPTVKGIR 215
           +F   R  +E+ G+++ L PK    +MG+   G  +  +G  D I E+R  +  T  GI 
Sbjct: 289 RFNTARRSLEICGERIPLSPKDVELVMGLAASGKDVVNSGPDDLIVELRNSYNATNHGIS 348

Query: 216 IRTLEEVIEQLDEANKIFKVAFTLFAIATLLCPIGSY-ISTLFLHPIMDVSSIKSLNWAT 274
           +R LEE +    EA + FK +F L+A+ T+LCP     +S  FLH + ++ +I   NW  
Sbjct: 349 VRLLEERLAA-PEAGEEFKRSFILYALGTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGK 407

Query: 275 FCYDWLVKSICRFQNQQAAYIGGCLHFLQV 304
           F  D LV+ + RF   +   +GGCL FLQ+
Sbjct: 408 FLLDRLVREVSRFHQGKQRAVGGCLLFLQL 437




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225453104|ref|XP_002270459.1| PREDICTED: uncharacterized protein LOC100263780 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147783848|emb|CAN72428.1| hypothetical protein VITISV_032233 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583781|ref|XP_002532643.1| conserved hypothetical protein [Ricinus communis] gi|223527634|gb|EEF29746.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147795729|emb|CAN74236.1| hypothetical protein VITISV_004916 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077245|ref|XP_002305192.1| predicted protein [Populus trichocarpa] gi|222848156|gb|EEE85703.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147772140|emb|CAN64547.1| hypothetical protein VITISV_026046 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533899|ref|XP_003535495.1| PREDICTED: uncharacterized protein LOC100782920 [Glycine max] Back     alignment and taxonomy information
>gi|147798273|emb|CAN76862.1| hypothetical protein VITISV_001668 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856790|emb|CAN83476.1| hypothetical protein VITISV_019328 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 9e-05
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 0.001
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 0.001
smart0039870 smart00398, HMG, high mobility group 0.003
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
 Score = 39.9 bits (94), Expect = 9e-05
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 32 PTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERM 89
          P S+   F  +  E+  +L++EN  L     + K +G+ +K L  E+K  Y+++ E+ 
Sbjct: 4  PLSA---FFLFSQEQRAKLKAENPGLKNA-EISKILGEKWKNLSEEEKKPYEEKAEKE 57


Length = 69

>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
PF10536 363 PMD: Plant mobile domain; InterPro: IPR019557 This 99.98
PTZ0019994 high mobility group protein; Provisional 99.87
COG5648211 NHP6B Chromatin-associated proteins containing the 99.77
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.71
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.69
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.68
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.67
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.66
KOG038196 consensus HMG box-containing protein [General func 99.64
smart0039870 HMG high mobility group. 99.64
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.63
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.61
KOG0527331 consensus HMG-box transcription factor [Transcript 99.07
PF09331142 DUF1985: Domain of unknown function (DUF1985); Int 98.89
KOG4715410 consensus SWI/SNF-related matrix-associated actin- 98.7
KOG3248421 consensus Transcription factor TCF-4 [Transcriptio 98.55
KOG0528511 consensus HMG-box transcription factor SOX5 [Trans 98.14
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.32
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 97.27
KOG2746 683 consensus HMG-box transcription factor Capicua and 96.77
COG5648211 NHP6B Chromatin-associated proteins containing the 96.7
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 96.56
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 93.66
PF03078 458 ATHILA: ATHILA ORF-1 family; InterPro: IPR004312 A 91.3
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 87.27
>PF10536 PMD: Plant mobile domain; InterPro: IPR019557 This entry represents a domain found in a variety of transposases [] Back     alignment and domain information
Probab=99.98  E-value=2.8e-33  Score=270.72  Aligned_cols=182  Identities=22%  Similarity=0.349  Sum_probs=158.1

Q ss_pred             Ccchhhccc--cccccHHHHHHHHhcccCCcceEEEcCEEeeeChhhhhhhhcccCCCcccccCCCh---hHHHHHHHHh
Q 021075          133 GFESLLELR--CGKLKRKLCHWLVNQFKPERNIIELHGQKLELCPKMFSKIMGVKDGGMAIKINGAS---DHIAEVRRIF  207 (317)
Q Consensus       133 GFg~LL~i~--~~~l~~~L~~wL~~~~d~~t~~~~l~g~~i~it~~dV~~VLGLP~gG~~v~~~~~~---~~~~~l~~~~  207 (317)
                      |||+|+.|.  ..++++.|+.+|+++|+++|++|++++++++||++||.+|+|||+.|.+|......   +.++++.+..
T Consensus         1 ~~g~~~~i~~s~~~~~~~li~al~erW~~et~tF~~~~gEmtiTL~DV~~llGLpi~G~pv~~~~~~~~~~~~~~ll~~~   80 (363)
T PF10536_consen    1 GFGILDAIMASRITIDRSLISALVERWDPETNTFHFPWGEMTITLEDVAMLLGLPIDGRPVTGPLPPDWRDLCEELLGVS   80 (363)
T ss_pred             CchhHhhhhhhcCCCCHHHHHHHHHHhCcccCeeecccccccchhhhhhhccccccccccccCccccchhhHHHHHhccc
Confidence            899999999  89999999999999999999999999999999999999999999999999875432   3344443332


Q ss_pred             CC----CCCCcchHHHHHHHhhcccc-cchhhhhHHhhhhcceecccCCC--CCcccccccccccccccccchHHHHHHH
Q 021075          208 QP----TVKGIRIRTLEEVIEQLDEA-NKIFKVAFTLFAIATLLCPIGSY--ISTLFLHPIMDVSSIKSLNWATFCYDWL  280 (317)
Q Consensus       208 ~~----~~~~i~l~~L~~~l~~~~~~-~d~f~r~Fll~~i~~~L~Ptts~--vs~~yl~~l~D~~~i~~yNW~~~Vld~L  280 (317)
                      ..    .+..+.++++++.+.+.+++ .+.+.||||++.+|++|||+++.  |+..|++++.|++.+++||||.+||++|
T Consensus        81 ~~~~~~~~~~~~~~wl~~~~~~~~~~d~~~~~rAFll~~lg~~lfp~~~~~~v~~~~l~~~~~l~~~~~~~wg~a~La~l  160 (363)
T PF10536_consen   81 PQIKSKKGSSIRLSWLEEFFSNRPEDDEEQYHRAFLLYWLGSFLFPDKSGDYVSPRYLPLAVDLARIKRYAWGSAVLAYL  160 (363)
T ss_pred             ccccccccccchhhheeccccccccchHHHHHHHHHHHhhhceeccCCCcceeeeeEEeeeeccccccccccHHHHHHHH
Confidence            21    24566788999888544333 24899999999999999999877  9999999999999999999999999999


Q ss_pred             HHHHHHHhhcC--CccccccHHHHHHHHHhcCCCcc
Q 021075          281 VKSICRFQNQQ--AAYIGGCLHFLQVRPLLQLKLSI  314 (317)
Q Consensus       281 ~~~i~k~~~~~--~~~i~GCl~lLqi~Yld~l~~~~  314 (317)
                      +++|++++.+.  ..+++||+.|||+|+||||+++.
T Consensus       161 y~~L~~~~~~~~~~~~~~g~~~llq~W~werf~~~r  196 (363)
T PF10536_consen  161 YRDLCKASRKSASQSNIGGPLWLLQLWAWERFPVGR  196 (363)
T ss_pred             HHHHHHHhhhcccccccccceeeeccchhheeeccc
Confidence            99999998877  78999999999999999999763



>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>PF09331 DUF1985: Domain of unknown function (DUF1985); InterPro: IPR015410 This domain is functionally uncharacterised; it is found in a set of Arabidopsis thaliana (Mouse-ear cress) hypothetical proteins Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF03078 ATHILA: ATHILA ORF-1 family; InterPro: IPR004312 ATHILA is a group of Arabidopsis thaliana retrotransposons [] belonging to the Ty3/gypsy family of the long terminal repeat (LTR) class of eukaryotic retrotransposons[, ] Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 7e-05
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 2e-04
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-04
1hme_A77 High mobility group protein fragment-B; DNA-bindin 5e-04
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 5e-04
2yrq_A173 High mobility group protein B1; HMG box domain, DN 7e-04
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
 Score = 40.1 bits (94), Expect = 7e-05
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 38 GFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDER 88
          G+V + NE  +++R+ + DL     + K +G  + +L P +K RY    E+
Sbjct: 14 GYVRFLNERREQIRTRHPDLPFP-EITKMLGAEWSKLQPAEKQRYLDEAEK 63


>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.88
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.86
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.85
2lhj_A97 High mobility group protein homolog NHP1; structur 99.85
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.85
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.84
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.84
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.83
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.83
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.83
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.82
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.81
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.81
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.81
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.81
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.8
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.79
2cto_A93 Novel protein; high mobility group box domain, hel 99.78
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.78
1ckt_A71 High mobility group 1 protein; high-mobility group 99.77
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.77
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.76
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.75
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.75
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.75
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.74
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.74
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.73
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.73
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.72
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.71
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.71
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.7
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.67
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.66
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.6
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.6
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.57
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.51
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=99.88  E-value=3.6e-23  Score=161.07  Aligned_cols=76  Identities=20%  Similarity=0.374  Sum_probs=73.1

Q ss_pred             hhhcCCCCCCCCCCchhhHHHHHHHHHHHHhhCCCCchhhhhhhHHhhhhcCCChHHhhhhhhhhhhhccCCCCCCC
Q 021075           22 ILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERMGNSGNSNSH   98 (317)
Q Consensus        22 ~~~~~~~~~~pkr~~~~~~~f~~~~r~~~~~~~p~~~~~~~~~k~~g~~wk~l~~~ek~~y~~~a~~~~~~y~~~k~   98 (317)
                      +.|+++|||+||||+||||+|++++|.+++++||++++ .+|+|.+|+.|++||++||++|+++|++++.+|..++.
T Consensus        11 ~~k~~kdp~~pKrP~say~lF~~~~r~~~k~~~P~~~~-~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~   86 (90)
T 1wgf_A           11 QEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSE-SELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKSG   86 (90)
T ss_dssp             SCCCSSCCCCCCCCCCHHHHHHHHTHHHHHHHCTTSCH-HHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTTTCCCCS
T ss_pred             cCcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCH-HHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            55778999999999999999999999999999999999 99999999999999999999999999999999999875



>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-04
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: High mobility group protein 1, HMG1
species: Hamster (Cricetulus griseus) [TaxId: 10029]
 Score = 37.1 bits (86), Expect = 2e-04
 Identities = 10/52 (19%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 38 GFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERM 89
           F  + +E   +++ E+  LS+   + K +G+ +     + K  Y+K+  ++
Sbjct: 9  AFFLFCSEYRPKIKGEHPGLSIG-DVAKKLGEMWNNTAADDKQPYEKKAAKL 59


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.82
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.81
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.79
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.76
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.74
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.72
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.65
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.56
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.56
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 93.54
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.82  E-value=8.7e-21  Score=145.57  Aligned_cols=76  Identities=20%  Similarity=0.374  Sum_probs=72.4

Q ss_pred             hhhcCCCCCCCCCCchhhHHHHHHHHHHHHhhCCCCchhhhhhhHHhhhhcCCChHHhhhhhhhhhhhccCCCCCCC
Q 021075           22 ILRANGQDAVPTSSTYGFVSYFNEEVKRLRSENSDLSVTLGLRKHIGKTYKELPPEQKARYKKRDERMGNSGNSNSH   98 (317)
Q Consensus        22 ~~~~~~~~~~pkr~~~~~~~f~~~~r~~~~~~~p~~~~~~~~~k~~g~~wk~l~~~ek~~y~~~a~~~~~~y~~~k~   98 (317)
                      ...+++||++||||+||||+|++++|.+++++||+.++ .+|.+.+|+.|+.||++||++|.++|++++.+|+.+.+
T Consensus        11 ~~~~~~~~~~PKrP~say~lF~~e~r~~~~~~~p~~~~-~ei~k~l~~~W~~Ls~~eK~~Y~~~A~~~k~~y~~~~~   86 (90)
T d1wgfa_          11 QEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSE-SELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKSG   86 (90)
T ss_dssp             SCCCSSCCCCCCCCCCHHHHHHHHTHHHHHHHCTTSCH-HHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTTTCCCCS
T ss_pred             ccCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCH-HHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHhc
Confidence            45567899999999999999999999999999999999 89999999999999999999999999999999998875



>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure