Citrus Sinensis ID: 021084

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MDKFFNLKDFDVKPKHPSRESLRRWRSFCTIVKNPTRRFRMVANLDRRSEADKKIRQMQEQLRLALCIRDTLKLIESHEDVPIGDTDAGRFQEFVDDIISTVKCGDVKEKIRLALCIQETALQLIEVLSLLSLEDVSSSEYTMTEAAEAGRFQDLFDDVASISDDDAEISLLMELVYNFSLNEKYRRRIMSWQKGAPLGSGSFGSVYEGFTDDGFFFAVKEVSLQDQGTQGEQSVLQLEQEISLLGQFEHDNIVQYFGTEKDENKLYIFLELVTQGSLAKIYQEYHLKDSQVSAYTWQILNGLKYLHEQNVIHRPGA
ccccccccccccccccccHHHHHHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEccEEccccccEEEEEEcccccEEEEEEEECcccccccHHHHHHHHHHHHHHccccccccEEEEcEEECccEEEEEEEEcccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccc
**KF****DF************RRWRSFCTIVKNPTRRFRMVANLD*************EQLRLALCIRDTLKLIESHEDVPIGDTDAGRFQEFVDDIISTVK************************************************************************************RIMSWQKGAPLGSGSFGSVYEGFTDDGFFFAVKEVSL*********SVLQLEQEISLLGQFEHDNIVQYFGTEKDENKLYIFLELVTQGSLAKIYQEYHLKDSQVSAYTWQILNGLKYLHEQNVIHRP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKFFNLKDFDVKPKHPSRESLRRWRSFCTIVKNPTRRFRMVANLDRRSEADKKIRQMQEQLRLALCIRDTLKLIESHEDVPIGDTDAGRFQEFVDDIISTVKCGDVKEKIRLALCIQETALQLIEVLSLLSLEDVSSSEYTMTEAAEAGRFQDLFDDVASISDDDAEISLLMELVYNFSLNEKYRRRIMSWQKGAPLGSGSFGSVYEGFTDDGFFFAVKEVSLQDQGTQGEQSVLQLEQEISLLGQFEHDNIVQYFGTEKDENKLYIFLELVTQGSLAKIYQEYHLKDSQVSAYTWQILNGLKYLHEQNVIHRPGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PVF, chain A
Confidence level:very confident
Coverage over the Query: 178-317
View the alignment between query and template
View the model in PyMOL
Template: 2L1W, chain B
Confidence level:confident
Coverage over the Query: 21-45
View the alignment between query and template
View the model in PyMOL
Template: 4AQR, chain D
Confidence level:confident
Coverage over the Query: 17-76
View the alignment between query and template
View the model in PyMOL
Template: 3TL8, chain A
Confidence level:probable
Coverage over the Query: 171-314
View the alignment between query and template
View the model in PyMOL