Citrus Sinensis ID: 021111

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------

MDPKASKQPSQQEVANFLNIPQQQQQQQPQQLQQVNMGENKPAEIKDFQIVIADKEEQTKKQLAPKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALAAAGGSVSQQGASLTAGLHQKIDDLGSSRTSWGGLVGGNLVGRSHQMPAAGLWPQPVSGFGFQSSSSSGPSTGNLGTENSNYLQKMGFPGFDLPGTGTATTNMGPMSFTSILGSASNQQLPGLELGLSQDGHIGVLNPQTLTQIYQQMGHARVHQQQQQQQHPQQQQQAAPVNKDDSQGSGQ

cccccccccccccccccccccccHcccccHHHHccccccccccccccccEEEccccHHHcccccccccccccccccccccccEECccHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc

**********************************************************************************RIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASA*******************************************RSHQMPAAGLW*************************************FDLPGT****************************LGLSQDGHIGVLNPQTLTQIY*************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor TCP20	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes.	probable	Q9LSD5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted