Citrus Sinensis ID: 021165

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------

MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSAKKPAQAKESAKPKAKAEPKKEAPKPKAEAAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK

ccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHccccccEEEEEEEccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccccccEEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHcccccccccccccccccc

ccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEccHEcHHHHHHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHccHHHHHHHcccHHHHcccccccccccHHHccccccccccccccccccccccHHHHcccccccccccHHHcccccccHHHHHHHcccccccccccHHHHHHHHccccccEEEEEEEcccHHccEEEEcccHHHHHHHHHHHHHHHHHEEEEEEEccccccEEEEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccEcccccEcc

meidanisrwvyprlgymqyippaeEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMtksftsefphveRYFWTVANQPKIKKFLGdfkqaesvpavqsakkpaqakesakpkakaepkkeapkpkaeaaeeeeapkpkpknpldllppskmilddWKRLYSNTKSNFREVAIKGfwdmydpegyslwfcdykyndentVSFVTLNKVSGFLQRMDLARKYAFGKmliigneppykvkglwlfrgpeipkfvmdecydmelydwkkadisdEEQKERVNQMIedhepfegealldakcfk

meidanisrwvypRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESvpavqsakkpaqakesakpkakaepkkeapkpkaeaaeeeeapkpkpknpldllppSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDhepfegealldakcfk

MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSakkpaqakesakpkakaepkkeapkpkaeaaeeeeapkpkpknpldllppSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK

*****NISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDF***************************************************************MILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKA*********************************

MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAE******************************************************LPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK

MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQ*************************************************PKNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK

MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVMICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPA********************************************KNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDHEPFEGEALLDAKCFK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		316	2.2.26 [Sep-21-2011]
Q5Z627		416	Elongation factor 1-gamma	yes	no	0.990	0.752	0.8	1e-142
Q9FUM1		422	Elongation factor 1-gamma	N/A	no	1.0	0.748	0.765	1e-140
Q6YW46		418	Elongation factor 1-gamma	no	no	0.990	0.748	0.801	1e-140
O04487		414	Probable elongation facto	yes	no	0.987	0.753	0.765	1e-139
Q9ZRI7		418	Elongation factor 1-gamma	no	no	0.996	0.753	0.758	1e-133
Q9FVT2		413	Probable elongation facto	no	no	0.981	0.750	0.763	1e-132
P29694		437	Elongation factor 1-gamma	yes	no	0.971	0.702	0.367	1e-51
Q9D8N0		437	Elongation factor 1-gamma	yes	no	0.971	0.702	0.364	2e-51
Q29387		432	Elongation factor 1-gamma	yes	no	0.971	0.710	0.361	6e-51
A2Q127		437	Elongation factor 1-gamma	yes	no	0.971	0.702	0.361	7e-51

>sp\|Q5Z627\|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1	Back alignment and function desciption

 Score =  503 bits (1295), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 274/315 (86%), Gaps = 2/315 (0%)

Query: 2   EIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIVM 61
           E+DANI RW+YPRLG+  Y+P  EE A+ +LKR+L ALN HLASNTYLVGHSVTLADIVM
Sbjct: 104 EVDANIGRWLYPRLGFGPYVPVLEEFAITSLKRSLGALNTHLASNTYLVGHSVTLADIVM 163

Query: 62  ICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSAKKPAQ 121
            CNLYYGF  I+ KSFTSEFPHVERYFWT+ NQP  KK +GDFKQAESVP VQ  KK A 
Sbjct: 164 TCNLYYGFVRILIKSFTSEFPHVERYFWTMVNQPNFKKVIGDFKQAESVPPVQ--KKAAP 221

Query: 122 AKESAKPKAKAEPKKEAPKPKAEAAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNTK 181
            KES   +AK E  KEAPKPK EA+EEEEAPKPKPKNPLDLLPPSKMILD+WKRLYSNTK
Sbjct: 222 PKESKAKEAKKEAPKEAPKPKVEASEEEEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTK 281

Query: 182 SNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFGK 241
           +NFRE+AIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVT+NKV GFLQRMDL RKYAFGK
Sbjct: 282 TNFREIAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTMNKVGGFLQRMDLCRKYAFGK 341

Query: 242 MLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIEDH 301
           ML+IG+ PP+KVKGLWLFRG +IPKFVMDE YDMELY+W K D+SDE QKERVN MIED 
Sbjct: 342 MLVIGSTPPFKVKGLWLFRGQDIPKFVMDEVYDMELYEWTKVDLSDEAQKERVNAMIEDQ 401

Query: 302 EPFEGEALLDAKCFK 316
           EPFEGE LLDAKCFK
Sbjct: 402 EPFEGEDLLDAKCFK 416

Probably plays a role in anchoring the complex to other cellular components.
Oryza sativa subsp. japonica (taxid: 39947)

>sp\|Q9FUM1\|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1	Back alignment and function description

>sp\|Q6YW46\|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2	Back alignment and function description

>sp\|O04487\|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZRI7\|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1	Back alignment and function description

>sp\|Q9FVT2\|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1	Back alignment and function description

>sp\|P29694\|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3	Back alignment and function description

>sp\|Q9D8N0\|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3	Back alignment and function description

>sp\|Q29387\|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2	Back alignment and function description

>sp\|A2Q127\|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		316
227937359		418	translation elongation factor [Citrus ma	1.0	0.755	0.987	0.0
225465198		423	PREDICTED: elongation factor 1-gamma-lik	1.0	0.747	0.803	1e-149
147789055		423	hypothetical protein VITISV_021574 [Viti	1.0	0.747	0.797	1e-148
77416961		413	unknown [Solanum tuberosum]	0.981	0.750	0.774	1e-142
413926103		414	elongation factor 1-gamma 2 [Zea mays] g	0.977	0.746	0.772	1e-142
82623387		414	putative elongation factor 1-gamma-like	0.981	0.748	0.774	1e-142
357124051		413	PREDICTED: elongation factor 1-gamma 2-l	0.977	0.748	0.778	1e-142
226530767		414	elongation factor 1-gamma 2 [Zea mays] g	0.977	0.746	0.769	1e-141
116788938		424	unknown [Picea sitchensis]	1.0	0.745	0.760	1e-141
440573520		421	EF1Bgamma class glutathione S-transferas	0.996	0.748	0.765	1e-140

>gi\|227937359\|gb\|ACP43319.1\| translation elongation factor [Citrus maxima]	Back alignment and taxonomy information

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/316 (98%), Positives = 314/316 (99%)

Query: 1   MEIDANISRWVYPRLGYMQYIPPAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIV 60
           MEIDANISRW+YPRLGYMQYIP AEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIV
Sbjct: 103 MEIDANISRWLYPRLGYMQYIPLAEEGAVAALKRALDALNIHLASNTYLVGHSVTLADIV 162

Query: 61  MICNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSAKKPA 120
           MICNLYYGFK IMTK+FTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSAKKPA
Sbjct: 163 MICNLYYGFKHIMTKTFTSEFPHVERYFWTVANQPKIKKFLGDFKQAESVPAVQSAKKPA 222

Query: 121 QAKESAKPKAKAEPKKEAPKPKAEAAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNT 180
           QAKESAKPKAKAEPKKEAPKPKAEAAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNT
Sbjct: 223 QAKESAKPKAKAEPKKEAPKPKAEAAEEEEAPKPKPKNPLDLLPPSKMILDDWKRLYSNT 282

Query: 181 KSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFG 240
           KSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFG
Sbjct: 283 KSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKYAFG 342

Query: 241 KMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIED 300
           KMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIED
Sbjct: 343 KMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADISDEEQKERVNQMIED 402

Query: 301 HEPFEGEALLDAKCFK 316
           HEPFEGEALLDAKCFK
Sbjct: 403 HEPFEGEALLDAKCFK 418

Source: Citrus maxima

Species: Citrus maxima

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225465198\|ref\|XP_002264400.1\| PREDICTED: elongation factor 1-gamma-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147789055\|emb\|CAN75785.1\| hypothetical protein VITISV_021574 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|77416961\|gb\|ABA81876.1\| unknown [Solanum tuberosum]	Back alignment and taxonomy information

>gi\|413926103\|gb\|AFW66035.1\| elongation factor 1-gamma 2 [Zea mays] gi\|413926104\|gb\|AFW66036.1\| elongation factor 1-gamma 2 [Zea mays]	Back alignment and taxonomy information

>gi\|82623387\|gb\|ABB87108.1\| putative elongation factor 1-gamma-like [Solanum tuberosum]	Back alignment and taxonomy information

>gi\|357124051\|ref\|XP_003563720.1\| PREDICTED: elongation factor 1-gamma 2-like [Brachypodium distachyon]	Back alignment and taxonomy information

>gi\|226530767\|ref\|NP_001151229.1\| elongation factor 1-gamma 2 [Zea mays] gi\|195645182\|gb\|ACG42059.1\| elongation factor 1-gamma 2 [Zea mays]	Back alignment and taxonomy information

>gi\|116788938\|gb\|ABK25057.1\| unknown [Picea sitchensis]	Back alignment and taxonomy information

>gi\|440573520\|gb\|AGC13144.1\| EF1Bgamma class glutathione S-transferase [Pinus tabuliformis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		316
TAIR\|locus:2024311		414	AT1G09640 [Arabidopsis thalian	0.477	0.364	0.887	2.9e-116
TAIR\|locus:2206535		413	AT1G57720 [Arabidopsis thalian	0.477	0.365	0.887	2.6e-115
ZFIN\|ZDB-GENE-020423-3		486	eef1g "eukaryotic translation	0.430	0.279	0.349	4.3e-44
MGI\|MGI:1914410		437	Eef1g "eukaryotic translation	0.468	0.338	0.348	1.7e-43
RGD\|1302939		437	Eef1g "eukaryotic translation	0.468	0.338	0.341	3.8e-43
UNIPROTKB\|Q29387		432	EEF1G "Elongation factor 1-gam	0.468	0.342	0.341	4.6e-43
UNIPROTKB\|F1MG05		440	EEF1G "Elongation factor 1-gam	0.468	0.336	0.354	8.2e-43
UNIPROTKB\|E2R574		437	EEF1G "Uncharacterized protein	0.468	0.338	0.341	2.3e-42
UNIPROTKB\|Q3SZV3		440	EEF1G "Elongation factor 1-gam	0.468	0.336	0.354	3.2e-42
UNIPROTKB\|P26641		437	EEF1G "Elongation factor 1-gam	0.468	0.338	0.348	3.3e-42

TAIR\|locus:2024311 AT1G09640 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 741 (265.9 bits), Expect = 2.9e-116, Sum P(2) = 2.9e-116
 Identities = 134/151 (88%), Positives = 141/151 (93%)

Query:   166 SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS 225
             S M+LDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN VSFVTLNKV 
Sbjct:   264 SPMVLDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENMVSFVTLNKVG 323

Query:   226 GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDECYDMELYDWKKADI 285
             GFLQRMDLARKY+FGKMLI G+E P+KVKGLWLFRGPEIPKF+MDE YDMELY+W K DI
Sbjct:   324 GFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYDMELYEWTKVDI 383

Query:   286 SDEEQKERVNQMIEDHEPFEGEALLDAKCFK 316
             SDE QKERV+QMIED EPFEGEALLDAKCFK
Sbjct:   384 SDEAQKERVSQMIEDAEPFEGEALLDAKCFK 414

GO:0003746 "translation elongation factor activity" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=IEA

GO:0006414 "translational elongation" evidence=IEA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005773 "vacuole" evidence=IDA

TAIR\|locus:2206535 AT1G57720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-020423-3 eef1g "eukaryotic translation elongation factor 1 gamma" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1914410 Eef1g "eukaryotic translation elongation factor 1 gamma" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1302939 Eef1g "eukaryotic translation elongation factor 1 gamma" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q29387 EEF1G "Elongation factor 1-gamma" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MG05 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R574 EEF1G "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZV3 EEF1G "Elongation factor 1-gamma" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P26641 EEF1G "Elongation factor 1-gamma" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9FUM1	EF1G_PRUAV	No assigned EC number	0.7656	1.0	0.7488	N/A	no
Q5Z627	EF1G3_ORYSJ	No assigned EC number	0.8	0.9905	0.7524	yes	no
O04487	EF1G1_ARATH	No assigned EC number	0.7658	0.9873	0.7536	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	BRADI1G37490.1	annotation not avaliable (413 aa)
		(Brachypodium distachyon)
Predicted Functional Partners:
	BRADI2G35620.1	annotation not avaliable (265 aa)	•		0.620
	BRADI4G10920.1	annotation not avaliable (168 aa)	•	•	0.595
	BRADI1G27330.1	annotation not avaliable (216 aa)	•		0.559
	BRADI1G51650.1	annotation not avaliable (127 aa)	•		0.522
	BRADI2G06250.1	annotation not avaliable (157 aa)	•		0.520
	BRADI3G13750.1	annotation not avaliable (110 aa)	•		0.500
	BRADI3G29060.1	annotation not avaliable (145 aa)	•		0.499
	BRADI1G05510.1	annotation not avaliable (404 aa)	•		0.477
	BRADI1G55510.1	annotation not avaliable (404 aa)	•		0.474
	BRADI1G59110.1	annotation not avaliable (161 aa)	•		0.467

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		316
pfam00647		105	pfam00647, EF1G, Elongation factor 1 gamma, conser	1e-50
cd03181		123	cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans	2e-45
cd10294		123	cd10294, GST_C_ValRS_N, Glutathione S-transferase	2e-15
cd10305		101	cd10305, GST_C_AIMP3, Glutathione S-transferase C-	1e-12
cd10289		82	cd10289, GST_C_AaRS_like, Glutathione S-transferas	1e-10
pfam00043		92	pfam00043, GST_C, Glutathione S-transferase, C-ter	6e-09
cd03189		123	cd03189, GST_C_GTT1_like, C-terminal, alpha helica	9e-08
cd00299		100	cd00299, GST_C_family, C-terminal, alpha helical d	4e-07
pfam13410		69	pfam13410, GST_C_2, Glutathione S-transferase, C-t	1e-06
cd10309		81	cd10309, GST_C_GluProRS_N, Glutathione S-transfera	2e-06
COG0625		211	COG0625, Gst, Glutathione S-transferase [Posttrans	5e-06
cd03178		110	cd03178, GST_C_Ure2p_like, C-terminal, alpha helic	8e-06
PLN02907		722	PLN02907, PLN02907, glutamate-tRNA ligase	2e-05
cd10306		87	cd10306, GST_C_GluRS_N, Glutathione S-transferase	2e-05
cd03180		110	cd03180, GST_C_2, C-terminal, alpha helical domain	4e-05
cd03177		117	cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he	6e-05
cd10292		118	cd10292, GST_C_YghU_like, C-terminal, alpha helica	1e-04
PTZ00144		418	PTZ00144, PTZ00144, dihydrolipoamide succinyltrans	6e-04
cd03190		142	cd03190, GST_C_Omega_like, C-terminal, alpha helic	7e-04
cd03207		101	cd03207, GST_C_8, C-terminal, alpha helical domain	7e-04
PRK11752		264	PRK11752, PRK11752, putative S-transferase; Provis	0.001
TIGR02927		579	TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena	0.001
cd03188		113	cd03188, GST_C_Beta, C-terminal, alpha helical dom	0.001
PRK04950		213	PRK04950, PRK04950, ProP expression regulator; Pro	0.001
pfam14181		155	pfam14181, YqfQ, YqfQ-like protein	0.002
cd03206		100	cd03206, GST_C_7, C-terminal, alpha helical domain	0.002
cd03183		126	cd03183, GST_C_Theta, C-terminal, alpha helical do	0.003
cd10308		82	cd10308, GST_C_eEF1b_like, Glutathione S-transfera	0.003
PRK00708		209	PRK00708, PRK00708, sec-independent translocase; P	0.004
PRK14520		155	PRK14520, rpsP, 30S ribosomal protein S16; Provisi	0.004

>gnl\|CDD\|201369 pfam00647, EF1G, Elongation factor 1 gamma, conserved domain	Back alignment and domain information

 Score =  163 bits (414), Expect = 1e-50
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 2/107 (1%)

Query: 157 KNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 216
           KNPLD LP S   LD+WKR YSN  +  R VA+  FW+ +DPEGYS+W+ +YKYNDE  +
Sbjct: 1   KNPLDALPKSTFNLDEWKRQYSNEDT--RTVALPYFWEHFDPEGYSIWYVEYKYNDELKL 58

Query: 217 SFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPE 263
            F+T N + GF QR++ +RKYAFG + + G +    + G+W+FRG E
Sbjct: 59  VFMTCNLIGGFFQRLEKSRKYAFGSVSVYGEDNNSDISGVWVFRGQE 105

Length = 105

>gnl\|CDD\|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins	Back alignment and domain information

>gnl\|CDD\|198327 cd10294, GST_C_ValRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of vertebrate Valyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3	Back alignment and domain information

>gnl\|CDD\|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains	Back alignment and domain information

>gnl\|CDD\|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family	Back alignment and domain information

>gnl\|CDD\|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins	Back alignment and domain information

>gnl\|CDD\|215492 PLN02907, PLN02907, glutamate-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198325 cd10292, GST_C_YghU_like, C-terminal, alpha helical domain of Escherichia coli Yghu Glutathione S-transferases and related uncharacterized proteins	Back alignment and domain information

>gnl\|CDD\|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|183298 PRK11752, PRK11752, putative S-transferase; Provisional	Back alignment and domain information

>gnl\|CDD\|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase	Back alignment and domain information

>gnl\|CDD\|198297 cd03188, GST_C_Beta, C-terminal, alpha helical domain of Class Beta Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|235322 PRK04950, PRK04950, ProP expression regulator; Provisional	Back alignment and domain information

>gnl\|CDD\|222581 pfam14181, YqfQ, YqfQ-like protein	Back alignment and domain information

>gnl\|CDD\|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases	Back alignment and domain information

>gnl\|CDD\|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta	Back alignment and domain information

>gnl\|CDD\|234818 PRK00708, PRK00708, sec-independent translocase; Provisional	Back alignment and domain information

>gnl\|CDD\|184724 PRK14520, rpsP, 30S ribosomal protein S16; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		316
KOG1627		160	consensus Translation elongation factor EF-1 gamma	100.0
PF00647		107	EF1G: Elongation factor 1 gamma, conserved domain;	100.0
cd03181		123	GST_C_EFB1gamma GST_C family, Gamma subunit of Elo	99.58
cd03178		113	GST_C_Ure2p_like GST_C family, Ure2p-like subfamil	99.42
cd03187		118	GST_C_Phi GST_C family, Class Phi subfamily; compo	99.42
cd03188		114	GST_C_Beta GST_C family, Class Beta subfamily; GST	99.42
PF00043		95	GST_C: Glutathione S-transferase, C-terminal domai	99.4
cd03180		110	GST_C_2 GST_C family, unknown subfamily 2; compose	99.39
cd03182		117	GST_C_GTT2_like GST_C family, Saccharomyces cerevi	99.38
cd03207		103	GST_C_8 GST_C family, unknown subfamily 8; compose	99.38
cd03196		115	GST_C_5 GST_C family, unknown subfamily 5; compose	99.36
cd03206		100	GST_C_7 GST_C family, unknown subfamily 7; compose	99.35
cd03204		111	GST_C_GDAP1 GST_C family, Ganglioside-induced diff	99.35
cd03177		118	GST_C_Delta_Epsilon GST_C family, Class Delta and	99.32
cd03183		126	GST_C_Theta GST_C family, Class Theta subfamily; c	99.32
cd03191		121	GST_C_Zeta GST_C family, Class Zeta subfamily; GST	99.31
cd03186		107	GST_C_SspA GST_N family, Stringent starvation prot	99.31
cd03189		119	GST_C_GTT1_like GST_C family, Saccharomyces cerevi	99.29
cd03209		121	GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar	99.29
cd03198		134	GST_C_CLIC GST_C family, Chloride Intracellular Ch	99.29
cd03185		126	GST_C_Tau GST_C family, Class Tau subfamily; GSTs	99.28
cd03201		121	GST_C_DHAR GST_C family, Dehydroascorbate Reductas	99.25
PF13410		69	GST_C_2: Glutathione S-transferase, C-terminal dom	99.24
cd03190		142	GST_C_ECM4_like GST_C family, ECM4-like subfamily;	99.24
PLN02395		215	glutathione S-transferase	99.23
PLN02473		214	glutathione S-transferase	99.23
cd03210		126	GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar	99.22
cd03184		124	GST_C_Omega GST_C family, Class Omega subfamily; G	99.21
PRK13972		215	GSH-dependent disulfide bond oxidoreductase; Provi	99.21
PRK10542		201	glutathionine S-transferase; Provisional	99.13
cd03208		137	GST_C_Alpha GST_C family, Class Alpha subfamily; G	99.13
TIGR01262		210	maiA maleylacetoacetate isomerase. Maleylacetoacet	99.12
PRK10357		202	putative glutathione S-transferase; Provisional	99.12
cd03179		105	GST_C_1 GST_C family, unknown subfamily 1; compose	99.1
PRK09481		211	sspA stringent starvation protein A; Provisional	99.09
cd03203		120	GST_C_Lambda GST_C family, Class Lambda subfamily;	99.06
cd03194		114	GST_C_3 GST_C family, unknown subfamily 3; compose	99.06
cd00299		100	GST_C_family Glutathione S-transferase (GST) famil	99.05
PTZ00057		205	glutathione s-transferase; Provisional	99.05
cd03195		114	GST_C_4 GST_C family, unknown subfamily 4; compose	99.0
PLN02378		213	glutathione S-transferase DHAR1	98.98
COG0625		211	Gst Glutathione S-transferase [Posttranslational m	98.98
PRK11752		264	putative S-transferase; Provisional	98.95
cd03192		104	GST_C_Sigma_like GST_C family, Class Sigma_like; c	98.94
KOG0867		226	consensus Glutathione S-transferase [Posttranslati	98.91
cd03193		88	GST_C_Metaxin GST_C family, Metaxin subfamily; com	98.91
cd03205		98	GST_C_6 GST_C family, unknown subfamily 6; compose	98.89
cd03200		96	GST_C_JTV1 GST_C family, JTV-1 subfamily; composed	98.87
TIGR00862		236	O-ClC intracellular chloride channel protein. Thes	98.86
PF14497		99	GST_C_3: Glutathione S-transferase, C-terminal dom	98.86
cd03202		124	GST_C_etherase_LigE GST_C family, Beta etherase Li	98.84
PLN02817		265	glutathione dehydrogenase (ascorbate)	98.82
KOG4420		325	consensus Uncharacterized conserved protein (Gangl	98.79
PRK15113		214	glutathione S-transferase; Provisional	98.78
PRK10387		210	glutaredoxin 2; Provisional	98.68
PLN02907		722	glutamate-tRNA ligase	98.59
cd03212		137	GST_C_Metaxin1_3 GST_C family, Metaxin subfamily,	98.48
cd03211		126	GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me	98.36
KOG1695		206	consensus Glutathione S-transferase [Posttranslati	98.36
TIGR02182		209	GRXB Glutaredoxin, GrxB family. This model include	98.32
KOG0406		231	consensus Glutathione S-transferase [Posttranslati	98.25
KOG0868		217	consensus Glutathione S-transferase [Posttranslati	98.25
cd03197		149	GST_C_mPGES2 GST_C family; microsomal Prostaglandi	98.24
COG0435		324	ECM4 Predicted glutathione S-transferase [Posttran	98.2
KOG2903		319	consensus Predicted glutathione S-transferase [Pos	97.92
KOG1422		221	consensus Intracellular Cl- channel CLIC, contains	97.61
PF14834		117	GST_C_4: Glutathione S-transferase, C-terminal dom	97.07
KOG1147		712	consensus Glutamyl-tRNA synthetase [Translation, r	96.26
KOG4244		281	consensus Failed axon connections (fax) protein/gl	95.96
KOG3027		257	consensus Mitochondrial outer membrane protein Met	95.9
PF04399		132	Glutaredoxin2_C: Glutaredoxin 2, C terminal domain	94.77
cd03199		128	GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub	93.21
KOG3028		313	consensus Translocase of outer mitochondrial membr	92.97
KOG3029		370	consensus Glutathione S-transferase-related protei	91.2
KOG1668		231	consensus Elongation factor 1 beta/delta chain [Tr	89.65

>KOG1627 consensus Translation elongation factor EF-1 gamma [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=3.5e-76  Score=494.56  Aligned_cols=156  Identities=51%  Similarity=0.938  Sum_probs=150.9

Q ss_pred             CCCCCCCCCCCchhhhhhhhccCCCcchhhhhhhhhhccCCCCceEEEEeeecCCCcceeEEeccchhhHHHhhhhhhhh
Q 021165          158 NPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKY  237 (316)
Q Consensus       158 ~pl~~lp~~~f~ld~~Kr~ysN~~~~~~~~a~~~fwe~~d~e~~S~w~~~yky~~el~~~fms~Nli~Gf~qRl~~~rK~  237 (316)
                      |||++||+|+|+||+|||+|||+||  +.+|||||||||||||||||+|+||||+||+++||||||||||||||+++|||
T Consensus         1 ~pl~~lp~~~Fvldd~kr~ySn~dt--~~~a~P~f~e~~d~e~ys~w~~~Yky~eeL~~~fms~nli~g~~qrl~~~rk~   78 (160)
T KOG1627|consen    1 DPLDLLPKSTFVLDDWKRKYSNEDT--REVALPWFWEHFDPEGYSLWKVDYKYNEELTLTFMSCNLIGGFFQRLDKSRKY   78 (160)
T ss_pred             CchhhCCCCccchhhhhhhhccccc--ccccchHHHHHhCcccceeeeccccCchHHHHHHHHhhhhhHHHHHHHHHHHh
Confidence            7999999999999999999999999  77999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEEeeCCCcceEEEEEEeCCCCCcccc--cccccccceeeEEcCCCCHHHHHHHHHHHhcCCCC--CCeeecccc
Q 021165          238 AFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVM--DECYDMELYDWKKADISDEEQKERVNQMIEDHEPF--EGEALLDAK  313 (316)
Q Consensus       238 ~Fg~~~v~G~~~~~~I~G~~~~rG~~~~~~~~--~~~~d~e~y~~~kld~~~~edk~~v~~~~~~~~~~--~g~~~~~gk  313 (316)
                      +||||+|+|+|++++|+|+|+|||||+.+ .|  |++||||||+|||||++++|+|++|++||+|++++  +||.++|||
T Consensus        79 ~f~~~~~~g~~~~~~i~g~~~~rg~ela~-~~spDwq~D~EsY~~tKLD~~see~k~~V~ey~sWeg~f~~~Gkaf~qgK  157 (160)
T KOG1627|consen   79 AFGSMVLFGENGNSTISGAWVFRGQELAP-AFSPDWQPDYESYTWTKLDPGSEETKELVNEYFSWEGPFEGNGKAFNDGK  157 (160)
T ss_pred             hheeEEEeccCCCCcceEEEEEecccccc-ccCccccccccceeeeecCCCCHHHHHHHHHHHhhcccccccchhhhccc
Confidence            99999999999999999999999999733 66  99999999999999999999999999999999975  469999999


Q ss_pred             ccC
Q 021165          314 CFK  316 (316)
Q Consensus       314 v~K  316 (316)
                      |||
T Consensus       158 i~K  160 (160)
T KOG1627|consen  158 IFK  160 (160)
T ss_pred             ccC
Confidence            998

>PF00647 EF1G: Elongation factor 1 gamma, conserved domain; InterPro: IPR001662 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]	Back alignment and domain information

>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins	Back alignment and domain information

>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant	Back alignment and domain information

>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B	Back alignment and domain information

>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4	Back alignment and domain information

>PLN02395 glutathione S-transferase	Back alignment and domain information

>PLN02473 glutathione S-transferase	Back alignment and domain information

>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>PRK10542 glutathionine S-transferase; Provisional	Back alignment and domain information

>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>TIGR01262 maiA maleylacetoacetate isomerase	Back alignment and domain information

>PRK10357 putative glutathione S-transferase; Provisional	Back alignment and domain information

>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>PRK09481 sspA stringent starvation protein A; Provisional	Back alignment and domain information

>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs	Back alignment and domain information

>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>PTZ00057 glutathione s-transferase; Provisional	Back alignment and domain information

>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>PLN02378 glutathione S-transferase DHAR1	Back alignment and domain information

>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11752 putative S-transferase; Provisional	Back alignment and domain information

>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha	Back alignment and domain information

>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene	Back alignment and domain information

>TIGR00862 O-ClC intracellular chloride channel protein	Back alignment and domain information

>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B	Back alignment and domain information

>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>PLN02817 glutathione dehydrogenase (ascorbate)	Back alignment and domain information

>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]	Back alignment and domain information

>PRK15113 glutathione S-transferase; Provisional	Back alignment and domain information

>PRK10387 glutaredoxin 2; Provisional	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins	Back alignment and domain information

>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02182 GRXB Glutaredoxin, GrxB family	Back alignment and domain information

>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A	Back alignment and domain information

>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only]	Back alignment and domain information

>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		316
1pbu_A		162	Solution Structure Of The C-Terminal Domain Of The		2e-20
1nhy_A		219	Crystal Structure Of The Gst-Like Domain Of Elongat		8e-04

>pdb|1PBU|A Chain A, Solution Structure Of The C-Terminal Domain Of The Human Eef1bgamma Subunit Length = 162

Back alignment and structure

Iteration: 1

Score = 96.3 bits (238), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 53/154 (34%), Positives = 84/154 (54%), Gaps = 5/154 (3%) Query: 166 SKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVS 225 S LD++KR YSN + VA+ FW+ +D +G+SLW+ +Y++ +E T +F++ N ++ Sbjct: 11 STFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLIT 68 Query: 226 GFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIP-KFVMDECYDMELYDWKKAD 284 G QR+D RK AF +++ G + G+W+FRG E+ D D E Y W+K D Sbjct: 69 GMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLD 128 Query: 285 ISDEEQKERVNQMIEDHEPFE--GEALLDAKCFK 316 EE + V + F+ G+A K FK Sbjct: 129 PGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162

PyMOL of 1pbu

>pdb|1NHY|A Chain A, Crystal Structure Of The Gst-Like Domain Of Elongation Factor 1-Gamma From Saccharomyces Cerevisiae Length = 219

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		316
1pbu_A		162	Elongation factor 1-gamma; alpha/beta, translation	9e-69
1nhy_A		219	EF-1-gamma 1, elongation factor 1-gamma 1; protein	3e-34
2uz8_A		174	Eukaryotic translation elongation factor 1 epsilon	3e-21
3lxz_A		229	Glutathione S-transferase family protein; structur	6e-19
2hra_A		209	Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l	7e-13
1axd_A		209	Glutathione S-transferase I; transferase, herbicid	9e-13
1gnw_A		211	Glutathione S-transferase; herbicide detoxificatio	3e-11
1aw9_A		216	Glutathione S-transferase III; herbicide detoxific	1e-10
3ibh_A		233	GST-II, saccharomyces cerevisiae GTT2; glutathione	3e-10
3lsz_A		225	Glutathione S-transferase; xenobiotic, biodegradat	2e-09
3m8n_A		225	Possible glutathione S-transferase; PSI-II, struct	4e-09
1ljr_A		244	HGST T2-2, glutathione S-transferase; HET: GSH; 3.	7e-09
1bg5_A		254	MAB, fusion protein of alpha-Na,K-ATPase with glut	8e-09
1b8x_A		280	Protein (AML-1B); nuclear matrix targeting signal	1e-08
3ay8_A		216	Glutathione S-transferase; GST fold, GST binding,	2e-08
1v2a_A		210	Glutathione transferase GST1-6; glutathione S-tran	3e-08
1dug_A		234	Chimera of glutathione S-transferase-synthetic lin	3e-08
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	4e-08
1r5a_A		218	Glutathione transferase; glutathione S-transferase	5e-08
2c4j_A		218	Glutathione S-transferase MU 2; glutathione transf	1e-07
3gtu_B		224	Glutathione S-transferase; conjugation, detoxifica	1e-07
2cvd_A		198	Glutathione-requiring prostaglandin D synthase; gl	1e-07
2fhe_A		216	GST, glutathione S-transferase; transferase-substr	2e-07
1pn9_A		209	GST class-delta, glutathione S-transferase 1-6; pr	2e-07
4exj_A		238	Uncharacterized protein; transferase-like protein,	3e-07
2x64_A		207	Glutathione-S-transferase; detoxification enzyme;	4e-07
2ycd_A		230	Glutathione S-transferase; SOIL bacteria, herbicid	4e-07
3m3m_A		210	Glutathione S-transferase; PSI-II, structural geno	5e-07
1gsu_A		219	GST, CGSTM1-1, class-MU glutathione S-transferase;	5e-07
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	5e-07
2a2r_A		210	Glutathione S-transferase P; detoxification, nitri	5e-07
3iso_A		218	Putative glutathione transferase; GST; HET: GSH; 1	5e-07
3ein_A		209	GST class-theta, glutathione S-transferase 1-1; de	1e-06
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	2e-06
1m0u_A		249	GST2 gene product; flight muscle protein, sigma, t	2e-06
1zl9_A		207	GST class-sigma, glutathione S-transferase 5; glut	2e-06
1f2e_A		201	Glutathione S-transferase; GST complexed with glut	2e-06
3m1g_A		362	Putative glutathione S-transferase; ECM4-like subf	2e-06
4g9h_A		211	Glutathione S-transferase; GST, enzyme function in	3e-06
3m0f_A		213	Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu	4e-06
2gsq_A		202	Squid GST, glutathione S-transferase; squid digest	4e-06
1yq1_A		208	Glutathione S-transferase; nematoda, structural ge	4e-06
2hnl_A		225	Glutathione S-transferase 1; prostaglandin synthas	5e-06
2dsa_A		203	Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu	6e-06
3r3e_A		328	Uncharacterized protein YQJG; thioredoxin domain,	6e-06
2on7_A		206	Nagst-1, Na glutathione S-transferase 1; hookworm;	7e-06
3tou_A		226	Glutathione S-transferase protein; GSH binding sit	7e-06
2ws2_A		204	NU-class GST, glutathione S-transferase; parasite,	7e-06
3f6d_A		219	Adgstd4-4, glutathione transferase GST1-4; HET: GT	8e-06
1pmt_A		203	PMGST, GST B1-1, glutathione transferase; glutathi	9e-06
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	9e-06
2wb9_A		211	Glutathione transferase sigma class; thioredoxin f	9e-06
3ppu_A		352	Glutathione-S-transferase; GST fold; HET: GSH; 2.3	1e-05
1tu7_A		208	Glutathione S-transferase 2; HET: GSH; 1.50A {Onch	2e-05
2on5_A		206	Nagst-2, Na glutathione S-transferase 2; hookworm;	2e-05
1tw9_A		206	Glutathione S-transferase 2; 1.71A {Heligmosomoide	2e-05
2pvq_A		201	Glutathione S-transferase; xenobiotics detoxificat	2e-05
1oe8_A		211	Glutathione S-transferase; schistosomiasis, detoxi	2e-05
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	3e-05
3n5o_A		235	Glutathione transferase; seattle structural genomi	3e-05
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	3e-05
1e6b_A		221	Glutathione S-transferase; 1.65A {Arabidopsis thal	4e-05
3c8e_A		288	YGHU, glutathione S-transferase homologue; glutath	4e-05
3h1n_A		252	Probable glutathione S-transferase; APC84167, bord	5e-05
1vf1_A		229	Glutathione S-transferase 3; detoxification; HET:	5e-05
1b48_A		221	GST, mgsta4-4, protein (glutathione S-transferase)	7e-05
3gx0_A		215	GST-like protein YFCG; transferase, glutathione, g	8e-05
3ik7_A		222	Glutathione S-transferase A4; human GST A4-4, enzy	9e-05
3lyk_A		216	Stringent starvation protein A homolog; structural	2e-04
2fno_A		248	AGR_PAT_752P; thioredoxin fold, GST C-terminal dom	2e-04
1k3y_A		221	GSTA1-1, glutathione S-transferase A1; S-hexyl glu	2e-04
1okt_A		211	Glutathione S-transferase; GST; 1.9A {Plasmodium f	2e-04
2hqt_A		124	GU4 nucleic-binding protein 1; GST-fold, biosynthe	4e-04
2cz2_A		223	Maleylacetoacetate isomerase; structural genomics,	5e-04
3uar_A		227	Glutathione S-transferase; GSH binding site; HET:	7e-04
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	8e-04

>1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1 Length = 162	Back alignment and structure

 Score =  210 bits (536), Expect = 9e-69
 Identities = 57/163 (34%), Positives = 89/163 (54%), Gaps = 5/163 (3%)

Query: 157 KNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 216
           K+P   LP S   LD++KR YSN  +    VA+  FW+ +D +G+SLW+ +Y++ +E T 
Sbjct: 2   KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59

Query: 217 SFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIP-KFVMDECYDM 275
           +F++ N ++G  QR+D  RK AF  +++ G      + G+W+FRG E+      D   D 
Sbjct: 60  TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119

Query: 276 ELYDWKKADISDEEQKERVNQMIEDHEPFE--GEALLDAKCFK 316
           E Y W+K D   EE +  V +       F+  G+A    K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162

PyMOL of 1pbu

>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219	Back alignment and structure

>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174	Back alignment and structure

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229	Back alignment and structure

>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209	Back alignment and structure

>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209	Back alignment and structure

>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211	Back alignment and structure

>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216	Back alignment and structure

>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233	Back alignment and structure

>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225	Back alignment and structure

>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225	Back alignment and structure

>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244	Back alignment and structure

>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254	Back alignment and structure

>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280	Back alignment and structure

>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216	Back alignment and structure

>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210	Back alignment and structure

>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218	Back alignment and structure

>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218	Back alignment and structure

>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224	Back alignment and structure

>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198	Back alignment and structure

>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216	Back alignment and structure

>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209	Back alignment and structure

>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238	Back alignment and structure

>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207	Back alignment and structure

>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230	Back alignment and structure

>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210	Back alignment and structure

>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243	Back alignment and structure

>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210	Back alignment and structure

>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218	Back alignment and structure

>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221	Back alignment and structure

>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249	Back alignment and structure

>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207	Back alignment and structure

>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201	Back alignment and structure

>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Length = 362	Back alignment and structure

>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211	Back alignment and structure

>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213	Back alignment and structure

>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202	Back alignment and structure

>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208	Back alignment and structure

>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225	Back alignment and structure

>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203	Back alignment and structure

>3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328	Back alignment and structure

>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206	Back alignment and structure

>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226	Back alignment and structure

>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204	Back alignment and structure

>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219	Back alignment and structure

>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214	Back alignment and structure

>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211	Back alignment and structure

>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352	Back alignment and structure

>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208	Back alignment and structure

>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206	Back alignment and structure

>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206	Back alignment and structure

>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201	Back alignment and structure

>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211	Back alignment and structure

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242	Back alignment and structure

>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201	Back alignment and structure

>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221	Back alignment and structure

>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288	Back alignment and structure

>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252	Back alignment and structure

>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229	Back alignment and structure

>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221	Back alignment and structure

>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215	Back alignment and structure

>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222	Back alignment and structure

>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216	Back alignment and structure

>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248	Back alignment and structure

>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221	Back alignment and structure

>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211	Back alignment and structure

>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Length = 124	Back alignment and structure

>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223	Back alignment and structure

>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		316
1pbu_A		162	Elongation factor 1-gamma; alpha/beta, translation	100.0
1nhy_A		219	EF-1-gamma 1, elongation factor 1-gamma 1; protein	99.6
4glt_A		225	Glutathione S-transferase-like protein; structural	99.45
3lxz_A		229	Glutathione S-transferase family protein; structur	99.34
3gx0_A		215	GST-like protein YFCG; transferase, glutathione, g	99.33
2x64_A		207	Glutathione-S-transferase; detoxification enzyme;	99.33
4gci_A		211	Glutathione S-transferase; GST, enzyme function in	99.33
3tou_A		226	Glutathione S-transferase protein; GSH binding sit	99.32
4exj_A		238	Uncharacterized protein; transferase-like protein,	99.31
3lsz_A		225	Glutathione S-transferase; xenobiotic, biodegradat	99.31
3iso_A		218	Putative glutathione transferase; GST; HET: GSH; 1	99.3
3ibh_A		233	GST-II, saccharomyces cerevisiae GTT2; glutathione	99.3
3m3m_A		210	Glutathione S-transferase; PSI-II, structural geno	99.3
3r2q_A		202	Uncharacterized GST-like protein YIBF; transferase	99.3
4iel_A		229	Glutathione S-transferase, N-terminal domain PROT;	99.29
2pvq_A		201	Glutathione S-transferase; xenobiotics detoxificat	99.29
3gtu_B		224	Glutathione S-transferase; conjugation, detoxifica	99.29
1axd_A		209	Glutathione S-transferase I; transferase, herbicid	99.28
1gnw_A		211	Glutathione S-transferase; herbicide detoxificatio	99.28
3uar_A		227	Glutathione S-transferase; GSH binding site; HET:	99.28
4hz4_A		217	Glutathione-S-transferase; enzyme function initiat	99.28
1aw9_A		216	Glutathione S-transferase III; herbicide detoxific	99.28
1f2e_A		201	Glutathione S-transferase; GST complexed with glut	99.28
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	99.28
2gsq_A		202	Squid GST, glutathione S-transferase; squid digest	99.27
2c4j_A		218	Glutathione S-transferase MU 2; glutathione transf	99.27
3vk9_A		216	Glutathione S-transferase delta; glutathione bindi	99.27
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	99.27
4ikh_A		244	Glutathione S-transferase; enzyme function initiat	99.26
3n5o_A		235	Glutathione transferase; seattle structural genomi	99.26
2fhe_A		216	GST, glutathione S-transferase; transferase-substr	99.26
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	99.25
1gsu_A		219	GST, CGSTM1-1, class-MU glutathione S-transferase;	99.25
1dug_A		234	Chimera of glutathione S-transferase-synthetic lin	99.24
4gf0_A		215	Glutathione S-transferase; GST, enzyme function in	99.24
2dsa_A		203	Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu	99.24
2cz2_A		223	Maleylacetoacetate isomerase; structural genomics,	99.24
4hz2_A		230	Glutathione S-transferase domain; glutathione,enzy	99.23
3ein_A		209	GST class-theta, glutathione S-transferase 1-1; de	99.23
2on7_A		206	Nagst-1, Na glutathione S-transferase 1; hookworm;	99.23
1pmt_A		203	PMGST, GST B1-1, glutathione transferase; glutathi	99.23
3niv_A		222	Glutathione S-transferase; structural genomics, PS	99.23
4hi7_A		228	GI20122; GST, glutathione S-transferase, enzyme fu	99.22
3lyp_A		215	Stringent starvation protein A; structural genomic	99.22
1yq1_A		208	Glutathione S-transferase; nematoda, structural ge	99.22
1zl9_A		207	GST class-sigma, glutathione S-transferase 5; glut	99.22
1v2a_A		210	Glutathione transferase GST1-6; glutathione S-tran	99.22
3ay8_A		216	Glutathione S-transferase; GST fold, GST binding,	99.22
4ecj_A		244	Glutathione S-transferase; transferase-like protei	99.22
2on5_A		206	Nagst-2, Na glutathione S-transferase 2; hookworm;	99.22
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	99.21
3m0f_A		213	Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu	99.21
2v6k_A		214	Maleylpyruvate isomerase; glutathione-S-transferas	99.21
1r5a_A		218	Glutathione transferase; glutathione S-transferase	99.21
3lyk_A		216	Stringent starvation protein A homolog; structural	99.21
1tw9_A		206	Glutathione S-transferase 2; 1.71A {Heligmosomoide	99.2
1tu7_A		208	Glutathione S-transferase 2; HET: GSH; 1.50A {Onch	99.2
3ik7_A		222	Glutathione S-transferase A4; human GST A4-4, enzy	99.2
2cvd_A		198	Glutathione-requiring prostaglandin D synthase; gl	99.19
2a2r_A		210	Glutathione S-transferase P; detoxification, nitri	99.19
1pn9_A		209	GST class-delta, glutathione S-transferase 1-6; pr	99.19
2ycd_A		230	Glutathione S-transferase; SOIL bacteria, herbicid	99.18
2hra_A		209	Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l	99.17
4hoj_A		210	REGF protein; GST, glutathione S-transferase, enzy	99.17
2uz8_A		174	Eukaryotic translation elongation factor 1 epsilon	99.17
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	99.17
3f6d_A		219	Adgstd4-4, glutathione transferase GST1-4; HET: GT	99.17
3m8n_A		225	Possible glutathione S-transferase; PSI-II, struct	99.16
2vo4_A		219	2,4-D inducible glutathione S-transferase; herbici	99.15
1gwc_A		230	Glutathione S-transferase TSI-1; herbicide detoxif	99.15
3vln_A		241	GSTO-1, glutathione S-transferase omega-1; GST fol	99.15
1ljr_A		244	HGST T2-2, glutathione S-transferase; HET: GSH; 3.	99.15
1b8x_A		280	Protein (AML-1B); nuclear matrix targeting signal	99.14
1e6b_A		221	Glutathione S-transferase; 1.65A {Arabidopsis thal	99.14
1k3y_A		221	GSTA1-1, glutathione S-transferase A1; S-hexyl glu	99.12
2wb9_A		211	Glutathione transferase sigma class; thioredoxin f	99.12
1k0m_A		241	CLIC1, NCC27, chloride intracellular channel prote	99.11
1yy7_A		213	SSPA, stringent starvation protein A; GST fold, tr	99.11
3fy7_A		250	Chloride intracellular channel protein 3; GST, glu	99.11
1b48_A		221	GST, mgsta4-4, protein (glutathione S-transferase)	99.11
1oe8_A		211	Glutathione S-transferase; schistosomiasis, detoxi	99.11
1m0u_A		249	GST2 gene product; flight muscle protein, sigma, t	99.11
3q18_A		239	GSTO-2, glutathione S-transferase omega-2; glutath	99.1
2hnl_A		225	Glutathione S-transferase 1; prostaglandin synthas	99.1
1vf1_A		229	Glutathione S-transferase 3; detoxification; HET:	99.1
1oyj_A		231	Glutathione S-transferase; herbicide detoxificatio	99.09
2r4v_A		247	XAP121, chloride intracellular channel protein 2;	99.09
4fqu_A		313	Putative glutathione transferase; glutathionyl-hyd	99.08
4g10_A		265	Glutathione S-transferase homolog; thioredoxin fol	99.08
4dej_A		231	Glutathione S-transferase related protein; transfe	99.08
2ahe_A		267	Chloride intracellular channel protein 4; glutathi	99.08
4id0_A		214	Glutathione S-transferase-like protein YIBF; GST,	99.07
3h1n_A		252	Probable glutathione S-transferase; APC84167, bord	99.07
4g0i_A		328	Protein YQJG; glutathionyl-hydroquinone reductase,	99.07
1okt_A		211	Glutathione S-transferase; GST; 1.9A {Plasmodium f	99.06
1k0d_A		260	URE2 protein; nitrate assimilation, structural gen	99.06
2ws2_A		204	NU-class GST, glutathione S-transferase; parasite,	99.05
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	99.03
3c8e_A		288	YGHU, glutathione S-transferase homologue; glutath	99.02
3bby_A		215	Uncharacterized GST-like protein YFCF; NP_416804.1	99.0
2yv9_A		291	Chloride intracellular channel EXC-4; chloride ION	98.98
3m1g_A		362	Putative glutathione S-transferase; ECM4-like subf	98.96
3rbt_A		246	Glutathione transferase O1; glutathione S-transfer	98.96
2hqt_A		124	GU4 nucleic-binding protein 1; GST-fold, biosynthe	98.96
2yv7_A		260	CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c	98.92
3ppu_A		352	Glutathione-S-transferase; GST fold; HET: GSH; 2.3	98.91
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	98.87
1bg5_A		254	MAB, fusion protein of alpha-Na,K-ATPase with glut	98.87
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	98.83
3ic8_A		310	Uncharacterized GST-like proteinprotein; glutathio	98.81
3ir4_A		218	Glutaredoxin 2; glutathione, IDP00895, structural	98.74
2fno_A		248	AGR_PAT_752P; thioredoxin fold, GST C-terminal dom	98.71
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	98.7
1z9h_A		290	Membrane-associated prostaglandin E synthase-2; me	98.49
4f03_A		253	Glutathione transferase; GST fold; 1.80A {Phaneroc	97.8
2hsn_A		160	Methionyl-tRNA synthetase, cytoplasmic; protein co	97.15

>1pbu_A Elongation factor 1-gamma; alpha/beta, translation; NMR {Homo sapiens} SCOP: d.58.46.1	Back alignment and structure

Probab=100.00  E-value=4.4e-83  Score=549.22  Aligned_cols=158  Identities=35%  Similarity=0.732  Sum_probs=153.7

Q ss_pred             CCCCCCCCCCCCCchhhhhhhhccCCCcchhhhhhhhhhccCCCCceEEEEeeecCCCcceeEEeccchhhHHHhhhhhh
Q 021165          156 PKNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLAR  235 (316)
Q Consensus       156 ~k~pl~~lp~~~f~ld~~Kr~ysN~~~~~~~~a~~~fwe~~d~e~~S~w~~~yky~~el~~~fms~Nli~Gf~qRl~~~r  235 (316)
                      +||||++||||+|+||+|||+|||+||  +++||||||||||+||||||+|+||||+|||++|||||||||||||||++|
T Consensus         1 ~k~Pl~~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySlw~~~Yky~del~~~FMs~NLI~GffQRle~~r   78 (162)
T 1pbu_A            1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR   78 (162)
T ss_dssp             CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred             CcChHHhCCCCCCCHHHHhhhccCCCc--hhhHHHHHHHhCCcccceEEEEEecCcccccceEEEechhhhHHHHHHHhh
Confidence            589999999999999999999999999  899999999999999999999999999999999999999999999999999


Q ss_pred             hhcceeEEEEeeCCCcceEEEEEEeCCCCCcccccc--cccccceeeEEcCCCCHHHHHHHHHHHhcCCC--CCCeeecc
Q 021165          236 KYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVMDE--CYDMELYDWKKADISDEEQKERVNQMIEDHEP--FEGEALLD  311 (316)
Q Consensus       236 K~~Fg~~~v~G~~~~~~I~G~~~~rG~~~~~~~~~~--~~d~e~y~~~kld~~~~edk~~v~~~~~~~~~--~~g~~~~~  311 (316)
                      |||||||+||||+|+++|+||||||||++ +|.+++  ++|||||+|+|||++++|||++|++||||+++  ++||+++|
T Consensus        79 KyaFg~~~v~Ge~~~~~I~Gvwv~RGq~~-~f~l~~d~~~D~esy~w~KLD~~~~e~k~~v~~y~~w~~~~~~~Gk~~~d  157 (162)
T 1pbu_A           79 KNAFASVILFGTNNSSSISGVWVFRGQEL-AFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ  157 (162)
T ss_dssp             GGEEECCEEESCSTTCEEEEEEEESSSSC-SGGGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred             heeeEEEEEEecCCCceEEEEEEEecCcc-eeeecccccccccceEEEEcCCCCHHHHHHHHHHhhcCCCcccCCEEccc
Confidence            99999999999999999999999999999 658876  77889999999999999999999999999997  89999999


Q ss_pred             ccccC
Q 021165          312 AKCFK  316 (316)
Q Consensus       312 gkv~K  316 (316)
                      |||||
T Consensus       158 gKvfK  162 (162)
T 1pbu_A          158 GKIFK  162 (162)
T ss_dssp             ECCCC
T ss_pred             ccccC
Confidence            99998

PyMOL of 1pbu

>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus}	Back alignment and structure

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A*	Back alignment and structure

>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli}	Back alignment and structure

>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa}	Back alignment and structure

>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A*	Back alignment and structure

>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A*	Back alignment and structure

>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239}	Back alignment and structure

>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis}	Back alignment and structure

>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A*	Back alignment and structure

>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens}	Back alignment and structure

>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli}	Back alignment and structure

>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria}	Back alignment and structure

>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A*	Back alignment and structure

>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A*	Back alignment and structure

>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A*	Back alignment and structure

>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A*	Back alignment and structure

>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae}	Back alignment and structure

>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A*	Back alignment and structure

>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A*	Back alignment and structure

>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ...	Back alignment and structure

>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori}	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha}	Back alignment and structure

>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens}	Back alignment and structure

>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A*	Back alignment and structure

>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A*	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A*	Back alignment and structure

>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A*	Back alignment and structure

>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A*	Back alignment and structure

>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter}	Back alignment and structure

>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A*	Back alignment and structure

>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A*	Back alignment and structure

>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus}	Back alignment and structure

>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A*	Back alignment and structure

>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus}	Back alignment and structure

>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A*	Back alignment and structure

>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp}	Back alignment and structure

>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis}	Back alignment and structure

>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A	Back alignment and structure

>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans}	Back alignment and structure

>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans}	Back alignment and structure

>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori}	Back alignment and structure

>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A*	Back alignment and structure

>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus}	Back alignment and structure

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A*	Back alignment and structure

>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A*	Back alignment and structure

>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A*	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae}	Back alignment and structure

>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A*	Back alignment and structure

>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A*	Back alignment and structure

>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1*	Back alignment and structure

>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ...	Back alignment and structure

>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A	Back alignment and structure

>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A	Back alignment and structure

>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae}	Back alignment and structure

>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens}	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A*	Back alignment and structure

>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A*	Back alignment and structure

>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris}	Back alignment and structure

>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A*	Back alignment and structure

>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A*	Back alignment and structure

>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A*	Back alignment and structure

>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ...	Back alignment and structure

>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A*	Back alignment and structure

>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A	Back alignment and structure

>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis}	Back alignment and structure

>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A	Back alignment and structure

>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A	Back alignment and structure

>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A*	Back alignment and structure

>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A*	Back alignment and structure

>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus}	Back alignment and structure

>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A	Back alignment and structure

>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A*	Back alignment and structure

>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum}	Back alignment and structure

>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis}	Back alignment and structure

>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis}	Back alignment and structure

>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A	Back alignment and structure

>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A*	Back alignment and structure

>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50}	Back alignment and structure

>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A*	Back alignment and structure

>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A*	Back alignment and structure

>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A	Back alignment and structure

>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus}	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A	Back alignment and structure

>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli}	Back alignment and structure

>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli}	Back alignment and structure

>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum}	Back alignment and structure

>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori}	Back alignment and structure

>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B	Back alignment and structure

>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster}	Back alignment and structure

>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium}	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV}	Back alignment and structure

>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A	Back alignment and structure

>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A*	Back alignment and structure

>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A*	Back alignment and structure

>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		316
d1pbua_		162	d.58.46.1 (A:) Elongation factor 1-gamma C-termina	9e-71
d1nhya1		144	a.45.1.1 (A:76-219) GST-like domain of elongation	3e-14
d1gnwa1		126	a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress	1e-09
d2gsta1		133	a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv	7e-09
d2hrkb1		118	a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1,	8e-09
d2c4ja1		133	a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi	2e-08
d1pmta1		121	a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi	2e-08
d1gsua1		133	a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus	2e-08
d1k0da1		151	a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni	4e-08
d1r5aa1		129	a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano	5e-08
d1v2aa1		125	a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano	6e-08
d1b48a1		143	a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu	1e-07
d1tw9a1		129	a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid	1e-07
d1jlva1		123	a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano	2e-07
d1f2ea1		121	a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p	4e-07
d1gula1		140	a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s	4e-07
d1n2aa1		121	a.45.1.1 (A:81-201) Class beta GST {Escherichia co	6e-07
d1aw9a1		135	a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays	1e-06
d1jlwa1		127	a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano	1e-06
d2a2ra1		132	a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi	1e-06
d2fhea1		136	a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa	1e-06
d1duga1		140	a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j	1e-06
d1m0ua1		127	a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D	2e-06
d1axda1		129	a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays	2e-06
d2gsqa1		127	a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast	3e-06
d2cvda1		124	a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s	5e-06
d3gtub1		140	a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi	2e-05
d1tu7a1		131	a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu	5e-05
d1k3ya1		142	a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s	6e-05
d1oe8a1		123	a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (	2e-04
d1okta1		126	a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla	0.001

>d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF1-gamma domain
family: eEF1-gamma domain
domain: Elongation factor 1-gamma C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  214 bits (547), Expect = 9e-71
 Identities = 57/163 (34%), Positives = 89/163 (54%), Gaps = 5/163 (3%)

Query: 157 KNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTV 216
           K+P   LP S   LD++KR YSN  +    VA+  FW+ +D +G+SLW+ +Y++ +E T 
Sbjct: 2   KDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQ 59

Query: 217 SFVTLNKVSGFLQRMDLARKYAFGKMLIIGNEPPYKVKGLWLFRGPEIP-KFVMDECYDM 275
           +F++ N ++G  QR+D  RK AF  +++ G      + G+W+FRG E+      D   D 
Sbjct: 60  TFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDY 119

Query: 276 ELYDWKKADISDEEQKERVNQMIEDHEPFE--GEALLDAKCFK 316
           E Y W+K D   EE +  V +       F+  G+A    K FK
Sbjct: 120 ESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 162

PyMOL of d1pbua_

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144	Back information, alignment and structure

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126	Back information, alignment and structure

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133	Back information, alignment and structure

>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118	Back information, alignment and structure

>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133	Back information, alignment and structure

>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121	Back information, alignment and structure

>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133	Back information, alignment and structure

>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151	Back information, alignment and structure

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129	Back information, alignment and structure

>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125	Back information, alignment and structure

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143	Back information, alignment and structure

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129	Back information, alignment and structure

>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123	Back information, alignment and structure

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121	Back information, alignment and structure

>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140	Back information, alignment and structure

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121	Back information, alignment and structure

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135	Back information, alignment and structure

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127	Back information, alignment and structure

>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132	Back information, alignment and structure

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136	Back information, alignment and structure

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140	Back information, alignment and structure

>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127	Back information, alignment and structure

>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129	Back information, alignment and structure

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127	Back information, alignment and structure

>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124	Back information, alignment and structure

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140	Back information, alignment and structure

>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131	Back information, alignment and structure

>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142	Back information, alignment and structure

>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123	Back information, alignment and structure

>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		316
d1pbua_		162	Elongation factor 1-gamma C-terminal domain {Human	100.0
d1nhya1		144	GST-like domain of elongation factor 1-gamma {Bake	99.81
d1gnwa1		126	Class phi GST {Mouse-ear cress (Arabidopsis thalia	99.6
d1axda1		129	Class phi GST {Maize (Zea mays), type I [TaxId: 45	99.59
d1f2ea1		121	Class beta GST {Sphingomonas paucimobilis [TaxId:	99.57
d1aw9a1		135	Class phi GST {Maize (Zea mays), type III [TaxId:	99.55
d1v2aa1		125	Class delta GST {Mosquito (Anopheles dirus b), iso	99.53
d1n2aa1		121	Class beta GST {Escherichia coli [TaxId: 562]}	99.52
d1jlwa1		127	Class delta GST {Mosquito (Anopheles dirus b), iso	99.51
d1pmta1		121	Class beta GST {Proteus mirabilis [TaxId: 584]}	99.5
d1jlva1		123	Class delta GST {Mosquito (Anopheles dirus b), iso	99.47
d1r5aa1		129	Class delta GST {Mosquito (Anopheles dirus b), iso	99.47
d2cvda1		124	Class sigma GST {Human (Homo sapiens) [TaxId: 9606	99.42
d3gtub1		140	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.4
d2gsta1		133	Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011	99.39
d1gsua1		133	Class mu GST {Chicken (Gallus gallus) [TaxId: 9031	99.38
d2c4ja1		133	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.38
d1tw9a1		129	Class sigma GST {Heligmosomoides polygyrus [TaxId:	99.37
d1fw1a1		125	Class zeta GST {Human (Homo sapiens) [TaxId: 9606]	99.36
d1k0da1		151	Yeast prion protein ure2p, nitrogen regulation fra	99.35
d1gwca1		138	Class tau GST {Aegilops tauschii, also known as Tr	99.34
d1duga1		140	Class alpha GST {Schistosoma japonicum [TaxId: 618	99.33
d1ljra1		165	Class theta GST {Human (Homo sapiens) [TaxId: 9606	99.32
d2gsqa1		127	Class sigma GST {Squid (Ommastrephes sloani pacifi	99.32
d2fhea1		136	Class alpha GST {Fasciola hepatica [TaxId: 6192]}	99.31
d1eema1		139	Class omega GST {Human (Homo sapiens) [TaxId: 9606	99.31
d1e6ba1		133	Class zeta GST {Mouse-ear cress (Arabidopsis thali	99.29
d1m0ua1		127	Class sigma GST {Fruit fly (Drosophila melanogaste	99.28
d2a2ra1		132	Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	99.28
d1k3ya1		142	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.24
d1b48a1		143	Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax	99.24
d1okta1		126	Pf GST {Malarial parasite (Plasmodium falciparum)	99.23
d1gula1		140	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.18
d1tu7a1		131	Class pi GST {Onchocerca volvulus [TaxId: 6282]}	99.09
d1oe8a1		123	Class alpha GST {Blood fluke (Schistosoma haematob	99.02
d2hrkb1		118	GU4 nucleic-binding protein 1, Arc1p {Baker's yeas	99.01
d1oyja1		145	Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	98.97
d1k0ma1		149	Chloride intracellular channel 1 (clic1) {Human (H	98.93
d1z9ha1		161	Microsomal prostaglandin E synthase-2 {Crab-eating	97.79
d1g7oa1		140	Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	93.89
d2fnoa1		149	Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac	80.21

>d1pbua_ d.58.46.1 (A:) Elongation factor 1-gamma C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF1-gamma domain
family: eEF1-gamma domain
domain: Elongation factor 1-gamma C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.3e-85  Score=558.50  Aligned_cols=158  Identities=36%  Similarity=0.728  Sum_probs=153.8

Q ss_pred             CCCCCCCCCCCCCchhhhhhhhccCCCcchhhhhhhhhhccCCCCceEEEEeeecCCCcceeEEeccchhhHHHhhhhhh
Q 021165          156 PKNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLAR  235 (316)
Q Consensus       156 ~k~pl~~lp~~~f~ld~~Kr~ysN~~~~~~~~a~~~fwe~~d~e~~S~w~~~yky~~el~~~fms~Nli~Gf~qRl~~~r  235 (316)
                      +|||||+||||+|+||+|||+|||+||  |++||||||||||+||||||+|+||||+||+++|||||||||||||||++|
T Consensus         1 aK~Pld~Lp~s~f~lD~wKR~YSN~dt--~~~a~p~Fwe~fD~egySiw~~~Yky~~el~~~fmt~Nli~Gf~QRle~~r   78 (162)
T d1pbua_           1 AKDPFAHLPKSTFALDEFKRKYSNEDT--LSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLR   78 (162)
T ss_dssp             CCCGGGSSCCCCSCHHHHHHHHHHSCG--GGTHHHHHHSSCCTTTCEEEEECCSCGGGCCCSTTHHHHHHHHHHHGGGTG
T ss_pred             CcChHHHCCCCCCCHHHHHHhhccCCc--HHHHHHHHHHhCCcccceEEEEEEecCccCccEEEEecchhHHHHHHHHHh
Confidence            589999999999999999999999999  999999999999999999999999999999999999999999999999999


Q ss_pred             hhcceeEEEEeeCCCcceEEEEEEeCCCCCcccc--cccccccceeeEEcCCCCHHHHHHHHHHHhcCCCC--CCeeecc
Q 021165          236 KYAFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVM--DECYDMELYDWKKADISDEEQKERVNQMIEDHEPF--EGEALLD  311 (316)
Q Consensus       236 K~~Fg~~~v~G~~~~~~I~G~~~~rG~~~~~~~~--~~~~d~e~y~~~kld~~~~edk~~v~~~~~~~~~~--~g~~~~~  311 (316)
                      |||||+|+||||+++++|+||||||||++|+ ++  +++||||||+|||||++++|||++|++||||++++  +||+++|
T Consensus        79 KyaFg~~~v~Ge~~~~~I~G~wv~RG~~~~~-~~~~d~~~D~Esy~~~KLD~~~~edk~~v~dy~~we~~~~~~gk~~~d  157 (162)
T d1pbua_          79 KNAFASVILFGTNNSSSISGVWVFRGQELAF-PLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQ  157 (162)
T ss_dssp             GGEEECCEEESCSTTCEEEEEEEESSSSCSG-GGCGGGCSSGGGSCCEECCTTSSHHHHHHHHHHHSCSCCTTTCSCCCE
T ss_pred             hhheeeEEEEeecCCceeEEEEEEcCCCCCc-cccccccCCccceEEEEcCCCCHHHHHHHHHHHccCCCcccCCeEccc
Confidence            9999999999999999999999999999976 65  78999999999999999999999999999999984  5999999


Q ss_pred             ccccC
Q 021165          312 AKCFK  316 (316)
Q Consensus       312 gkv~K  316 (316)
                      |||||
T Consensus       158 gkvfK  162 (162)
T d1pbua_         158 GKIFK  162 (162)
T ss_dssp             ECCCC
T ss_pred             ccccC
Confidence            99998

PyMOL of d1pbua_

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}	Back information, alignment and structure

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]}	Back information, alignment and structure

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}	Back information, alignment and structure

>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}	Back information, alignment and structure

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}	Back information, alignment and structure

>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}	Back information, alignment and structure

>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}	Back information, alignment and structure

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}	Back information, alignment and structure

>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}	Back information, alignment and structure

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}	Back information, alignment and structure

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}	Back information, alignment and structure

>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}	Back information, alignment and structure

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]}	Back information, alignment and structure

>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}	Back information, alignment and structure

>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}	Back information, alignment and structure

>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}	Back information, alignment and structure

>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}	Back information, alignment and structure

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure