BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021168
(316 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC
204508 / S288c) GN=YOR059C PE=1 SV=1
Length = 450
Score = 32.0 bits (71), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
Query: 28 GKILPRAVDGNLKYVGGETRVVAVPREINFSELMKKLSTIDDGDIVLKYQLIPEDLDSLV 87
G I+ A+D + Y + +V E+ + E ++K +TI+DG K++ +P D + V
Sbjct: 333 GSIINSALDMDANYEASNSNLVN-EEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKV 391
Query: 88 SVRNDEDVKHM 98
+RN +K +
Sbjct: 392 ILRNLNKLKWI 402
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.313 0.131 0.386
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 128,297,309
Number of Sequences: 539616
Number of extensions: 5621068
Number of successful extensions: 17327
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 178
Number of HSP's that attempted gapping in prelim test: 16353
Number of HSP's gapped (non-prelim): 709
length of query: 316
length of database: 191,569,459
effective HSP length: 117
effective length of query: 199
effective length of database: 128,434,387
effective search space: 25558443013
effective search space used: 25558443013
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)