BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021168
         (316 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q08448|YO059_YEAST Putative lipase YOR059C OS=Saccharomyces cerevisiae (strain ATCC
           204508 / S288c) GN=YOR059C PE=1 SV=1
          Length = 450

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 28  GKILPRAVDGNLKYVGGETRVVAVPREINFSELMKKLSTIDDGDIVLKYQLIPEDLDSLV 87
           G I+  A+D +  Y    + +V    E+ + E ++K +TI+DG    K++ +P D +  V
Sbjct: 333 GSIINSALDMDANYEASNSNLVN-EEELPWKEFIQKYTTINDGVWKSKFKKLPFDENRKV 391

Query: 88  SVRNDEDVKHM 98
            +RN   +K +
Sbjct: 392 ILRNLNKLKWI 402


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.313    0.131    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 128,297,309
Number of Sequences: 539616
Number of extensions: 5621068
Number of successful extensions: 17327
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 178
Number of HSP's that attempted gapping in prelim test: 16353
Number of HSP's gapped (non-prelim): 709
length of query: 316
length of database: 191,569,459
effective HSP length: 117
effective length of query: 199
effective length of database: 128,434,387
effective search space: 25558443013
effective search space used: 25558443013
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)