Citrus Sinensis ID: 021169


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLNNTTKATNNRTRALSAPSSLDAAEAEQDALASVEFEEQEESKSRAGLTKEQRSSSPQPLPLPSPHTQSAASLKATGSFKSGTASGPLFASGPLPLPPTGTGTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHccccEEEEHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEcccccccccEEEEEEEcccccccHHHHHHHHHHHHcccccccccEEEEEEccccccEEEEEEEcccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEccccccccc
cccEHEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccEEEEEEcccccccccccccccccccccccEcccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccHHccccccccccEEEEEcccccEccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHEHccccccEEEEEEEcccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccc
mgcftvlkskkkkpeqtvhlkrvnpqehtpttlpepqiptrslqsappsfrtrvkpiplnnttkatnnrtralsapsslDAAEAEQDALASVEfeeqeesksragltkeqrssspqplplpsphtqsaaslkatgsfksgtasgplfasgplplpptgtgtlrnfpldEVAAACHNFFSDRCISEGLSSVMYrasfgddastskkFEATvtrlnpssqgvKEFINDVNTlaslqhpnlckllgfhardgsdqRMLIYERLFHGSldrliygrsdgppidwntRVKIALCAAQgltflheegpfQVIFYYFEMIKTE
mgcftvlkskkkkpeqtvhlkrvnpqehtpttlpepqiptrslqsappsfrtrvkpiplnnttkatnnrtRALSAPSSLDAAEAEQDALASVEfeeqeesksragltkeqrssspqplplpSPHTQSAASLKATGSFKSGTASGPLFASGPLPLPPTGTGTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATvtrlnpssqgvKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLtflheegpFQVIFYYFEMIKTE
MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLnnttkatnnrtraLSAPSsldaaeaeqdalasVEFEEQEESKSRAGLTKEQRssspqplplpsphtqsAASLKATGSFKSGTASGPLFASgplplpptgtgtlRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE
***************************************************************************************************************************************************************GTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASF***********************VKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMI***
*GCFT********************************************************************SAPSSLDAAEAEQDALASVE**********************************************************************NFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKT*
MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLNNTTKATNNR*************************************************************LKATGSFKSGTASGPLFASGPLPLPPTGTGTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE
*GCFTVLKSKKKKPEQTVHLKRVNPQ**TPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLNNTTKATNNRTRALSAPSSLDAAEAEQDALASVEFEEQEESKS**************PLPLPSPHTQSAASLKATGSFKSGTA*****************GTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLNNTTKATNNRTRALSAPSSLDAAEAEQDALASVEFEEQEESKSRAGLTKEQRSSSPQPLPLPSPHTQSAASLKATGSFKSGTASGPLFASGPLPLPPTGTGTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q8H186 389 Probable receptor-like pr no no 0.455 0.370 0.376 5e-22
Q9LFP7 493 Probable receptor-like pr no no 0.462 0.296 0.367 4e-20
P43293 389 Probable serine/threonine no no 0.468 0.380 0.363 1e-19
Q9SRH7 490 Receptor-like serine/thre no no 0.462 0.297 0.367 1e-19
Q6NKZ9 437 Probable receptor-like se no no 0.506 0.366 0.344 6e-19
Q9LQQ8 423 Probable serine/threonine no no 0.408 0.304 0.391 5e-18
C0LGE0 1014 Probable LRR receptor-lik no no 0.436 0.136 0.361 7e-18
O49839 426 Protein kinase 2A, chloro no no 0.5 0.370 0.343 1e-17
Q9XI96 699 Proline-rich receptor-lik no no 0.560 0.253 0.326 1e-17
Q9FE20 456 Serine/threonine-protein no no 0.474 0.328 0.377 3e-17
>sp|Q8H186|Y3545_ARATH Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (261), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/154 (37%), Positives = 88/154 (57%), Gaps = 10/154 (6%)

Query: 161 TLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDAST----SKKFEATVTRLNPS 216
           T+++F  +E+  A  NF SD  + EG    ++R    +   T    S      V RLNP 
Sbjct: 45  TVKSFSFNELKLATRNFRSDSVVGEGGFGCVFRGWLDETTLTPTKSSSGLVIAVKRLNPD 104

Query: 217 S-QGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIY--GRS 273
             QG +E++ ++N L  L HPNL KL+G+   D  +QR+L+YE +  GSL+  ++  G  
Sbjct: 105 GFQGHREWLTEINYLGQLSHPNLVKLIGYCLED--EQRLLVYEFMHKGSLENHLFANGNK 162

Query: 274 DGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIF 307
           D  P+ W  R+K+AL AA+GL FLH + P +VI+
Sbjct: 163 DFKPLSWILRIKVALDAAKGLAFLHSD-PVKVIY 195





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=1 SV=1 Back     alignment and function description
>sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=2 SV=2 Back     alignment and function description
>sp|Q9SRH7|Y3130_ARATH Receptor-like serine/threonine-protein kinase At3g01300 OS=Arabidopsis thaliana GN=At3g01300 PE=2 SV=1 Back     alignment and function description
>sp|Q6NKZ9|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500 OS=Arabidopsis thaliana GN=At4g34500 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1 Back     alignment and function description
>sp|C0LGE0|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1 Back     alignment and function description
>sp|O49839|APK2A_ARATH Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=2 SV=1 Back     alignment and function description
>sp|Q9XI96|PERK7_ARATH Proline-rich receptor-like protein kinase PERK7 OS=Arabidopsis thaliana GN=PERK7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
255575572 543 protein kinase atsik, putative [Ricinus 0.943 0.548 0.721 1e-121
356568230 548 PREDICTED: probable receptor-like protei 0.952 0.549 0.755 1e-120
357469007 542 Protein kinase 2A [Medicago truncatula] 0.955 0.557 0.724 1e-119
356532163 549 PREDICTED: probable receptor-like protei 0.952 0.548 0.733 1e-118
388500644 522 unknown [Medicago truncatula] 0.955 0.578 0.721 1e-117
357506663 546 Protein kinase 2A [Medicago truncatula] 0.955 0.553 0.745 1e-116
297735543 660 unnamed protein product [Vitis vinifera] 0.955 0.457 0.719 1e-109
225439687 548 PREDICTED: probable receptor-like protei 0.955 0.551 0.725 1e-109
449502644 548 PREDICTED: probable receptor-like protei 0.952 0.549 0.688 1e-109
449449857 540 PREDICTED: probable receptor-like protei 0.952 0.557 0.688 1e-109
>gi|255575572|ref|XP_002528686.1| protein kinase atsik, putative [Ricinus communis] gi|223531858|gb|EEF33675.1| protein kinase atsik, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/312 (72%), Positives = 258/312 (82%), Gaps = 14/312 (4%)

Query: 1   MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEPQIPTRSLQSAPPSFRTRVKPIPLN 60
           MGCFTVLKSKKKKPE +V +KRV+P+E TPTTLPEPQIPTRSLQSAPPSFRTRVKP+  +
Sbjct: 1   MGCFTVLKSKKKKPEPSVSIKRVSPKEQTPTTLPEPQIPTRSLQSAPPSFRTRVKPVQPD 60

Query: 61  NTTKATNNRTRALSAPSSLDAAEAEQDALASVEFEEQEESKSRAGLTKEQRSSSPQPLPL 120
           N  +  NNR R  SAP SLD+AE  QD LA++E++E EE KSR  L ++  S  PQPLPL
Sbjct: 61  N--RLINNRARVKSAPESLDSAE--QDDLAAIEYDEHEELKSRVSLARDHLS--PQPLPL 114

Query: 121 PSPHTQSAASLKATGSFKSGTASGPLFASGPLPLPP--TGTGTLRNFPLDEVAAACHNFF 178
           P      AA+LK  GS K    SGPL+ASGPLPLPP  T +GTLRNF  DE+ +AC NF 
Sbjct: 115 P------AAALKPAGSLKFTNGSGPLYASGPLPLPPGVTQSGTLRNFSYDEIISACRNFS 168

Query: 179 SDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNL 238
           SDRC+SEGLSS++YRASFGDD S+SKKFEATVTRL+ S QG KEFIN+VNTLASL+HPNL
Sbjct: 169 SDRCVSEGLSSIIYRASFGDDTSSSKKFEATVTRLHSSPQGFKEFINEVNTLASLRHPNL 228

Query: 239 CKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLH 298
           CKLLG+HARDGS+QRMLIYERL+HGSLDRL+YGR DGPPIDWNTR+KIALCAAQGLTFLH
Sbjct: 229 CKLLGYHARDGSEQRMLIYERLYHGSLDRLLYGRLDGPPIDWNTRMKIALCAAQGLTFLH 288

Query: 299 EEGPFQVIFYYF 310
           EEGPFQ ++  F
Sbjct: 289 EEGPFQAMYNEF 300




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356568230|ref|XP_003552316.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Glycine max] Back     alignment and taxonomy information
>gi|357469007|ref|XP_003604788.1| Protein kinase 2A [Medicago truncatula] gi|355505843|gb|AES86985.1| Protein kinase 2A [Medicago truncatula] Back     alignment and taxonomy information
>gi|356532163|ref|XP_003534643.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Glycine max] Back     alignment and taxonomy information
>gi|388500644|gb|AFK38388.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357506663|ref|XP_003623620.1| Protein kinase 2A [Medicago truncatula] gi|355498635|gb|AES79838.1| Protein kinase 2A [Medicago truncatula] Back     alignment and taxonomy information
>gi|297735543|emb|CBI18037.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225439687|ref|XP_002271567.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449502644|ref|XP_004161702.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449857|ref|XP_004142681.1| PREDICTED: probable receptor-like protein kinase At5g15080-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2077768 557 ATSIK [Arabidopsis thaliana (t 0.955 0.542 0.526 1.4e-73
TAIR|locus:2064920 435 AT2G39110 [Arabidopsis thalian 0.563 0.409 0.329 8.9e-20
TAIR|locus:2180127 389 NAK [Arabidopsis thaliana (tax 0.458 0.372 0.371 1.1e-19
TAIR|locus:2151191 378 CDL1 "CDG1-like 1" [Arabidopsi 0.436 0.365 0.414 8e-19
TAIR|locus:2147805 493 AT5G15080 [Arabidopsis thalian 0.458 0.294 0.363 1e-18
TAIR|locus:2053250 462 AT2G28940 [Arabidopsis thalian 0.465 0.318 0.394 1.1e-18
TAIR|locus:2095517 453 AT3G28690 [Arabidopsis thalian 0.547 0.381 0.329 2.2e-18
TAIR|locus:2100282 490 AT3G01300 [Arabidopsis thalian 0.458 0.295 0.363 3.6e-18
TAIR|locus:2085069 418 AT3G09830 [Arabidopsis thalian 0.468 0.354 0.368 7.7e-18
TAIR|locus:2060167 442 AT2G07180 [Arabidopsis thalian 0.439 0.314 0.369 9.3e-18
TAIR|locus:2077768 ATSIK [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 743 (266.6 bits), Expect = 1.4e-73, P = 1.4e-73
 Identities = 167/317 (52%), Positives = 203/317 (64%)

Query:     1 MGCFTVLKSKKKKPEQTVHLKRVNPQEHTPTTLPEP-QIPTRSLQSAPPSFRTRVKPIPL 59
             +GCF  LKSKKK+   +V +KR++ +E  PT LPEP +IP+R+LQSAPPSFRTRVKPI  
Sbjct:     3 LGCFP-LKSKKKRG--SVSMKRLDLEESKPTALPEPPKIPSRNLQSAPPSFRTRVKPIQS 59

Query:    60 XXXXXXXXXXXXX-LSAPXXXXXXXXXXXXXXSVEFEEQEESKSRAGLTKEQRXXXXXXX 118
                           +SAP                  E+ E+ +     TKE         
Sbjct:    60 NNGGTGEMSSRARVMSAPSSIHGAAERDLLAGVYHDEQDEQPRDPRTSTKES-----SPQ 114

Query:   119 XXXXXXXXXAASLKATGSFKS-GTASGPLFASXXXXXXXXX--XXXXRNFPLDEVAAACH 175
                       +SLK  GSFKS   +SG L +S               R+F  DEV AAC+
Sbjct:   115 PLPLPSPRTGSSLKNWGSFKSFNGSSGRLSSSAAVSGPLPLPPSGSVRSFSYDEVMAACN 174

Query:   176 NFFSDRCISEGLSSVMYRASFGDDASTS--KKFEATVTRLNPSSQGVKEFINDVNTLASL 233
              F SDRC+ EGLSSVMY ASFGD+ASTS  KK +ATV RL+  +Q ++EFIN+VNTLASL
Sbjct:   175 AFSSDRCVMEGLSSVMYMASFGDEASTSGLKKVDATVVRLHVITQSIREFINEVNTLASL 234

Query:   234 QHPNLCKLLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQG 293
             QH NLCKL+G+HARDGSD RML+YERL  GSLDRL++GRSDGPP+DWNTR+KIALCAAQG
Sbjct:   235 QHQNLCKLVGYHARDGSDTRMLVYERLALGSLDRLLHGRSDGPPLDWNTRMKIALCAAQG 294

Query:   294 LTFLHEEGPFQVIFYYF 310
             LTFLHEEGPFQ ++  F
Sbjct:   295 LTFLHEEGPFQAMYNEF 311




GO:0004672 "protein kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0006914 "autophagy" evidence=RCA
TAIR|locus:2064920 AT2G39110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180127 NAK [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151191 CDL1 "CDG1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147805 AT5G15080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053250 AT2G28940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095517 AT3G28690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100282 AT3G01300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085069 AT3G09830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060167 AT2G07180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037493001
SubName- Full=Chromosome chr8 scaffold_88, whole genome shotgun sequence; (548 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-12
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-09
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-08
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 3e-08
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-08
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 2e-07
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-04
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-04
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-04
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 0.002
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 0.003
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
 Score = 63.8 bits (156), Expect = 5e-12
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 183 ISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLL 242
           + EG    +Y A    D  T KK    + +   SS  ++E + ++  L  L HPN+ KL 
Sbjct: 1   LGEGGFGTVYLAR---DKKTGKKVAIKIIKKEDSSSLLEELLREIEILKKLNHPNIVKLY 57

Query: 243 GFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEG 301
           G    +  +   L+ E    GSL  L+  + +   +  +  ++I L   +GL +LH  G
Sbjct: 58  GVFEDE--NHLYLVMEYCEGGSLKDLL--KENEGKLSEDEILRILLQILEGLEYLHSNG 112


Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
KOG1187 361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.96
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.96
KOG0192 362 consensus Tyrosine kinase specific for activated ( 99.94
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.94
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.94
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.92
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.92
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.92
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 99.92
KOG0580 281 consensus Serine/threonine protein kinase [Cell cy 99.91
KOG0610 459 consensus Putative serine/threonine protein kinase 99.91
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.91
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.91
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.91
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.9
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.9
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.9
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.9
KOG0605 550 consensus NDR and related serine/threonine kinases 99.9
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.89
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.89
KOG0198 313 consensus MEKK and related serine/threonine protei 99.89
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.89
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.89
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.89
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.89
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.89
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.89
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.89
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.88
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.88
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.88
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.88
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.88
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.88
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.88
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.88
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.88
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.88
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.88
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.88
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.88
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.88
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.88
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.88
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.88
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.87
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.87
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.87
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.87
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.87
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.87
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.87
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.87
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.87
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.87
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.87
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.87
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.87
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.87
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.87
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.87
KOG0584 632 consensus Serine/threonine protein kinase [General 99.87
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.87
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.87
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.87
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.87
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.87
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.87
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.86
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.86
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 99.86
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.86
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.86
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.86
PTZ00284 467 protein kinase; Provisional 99.86
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.86
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.86
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.86
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.86
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.86
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.86
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.86
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.86
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.86
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.86
PHA02988 283 hypothetical protein; Provisional 99.86
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.86
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.86
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.86
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.86
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.86
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.86
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.85
KOG0578 550 consensus p21-activated serine/threonine protein k 99.85
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.85
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.85
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.85
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.85
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.85
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.85
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.85
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.85
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.85
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.85
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.85
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.85
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.85
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.85
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.85
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.85
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.85
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.85
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.85
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.85
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.85
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.85
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.85
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.85
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.85
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.85
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.85
PHA03212 391 serine/threonine kinase US3; Provisional 99.85
PTZ00267 478 NIMA-related protein kinase; Provisional 99.85
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.85
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.85
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.85
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.85
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.85
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.85
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.85
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.85
PHA03211 461 serine/threonine kinase US3; Provisional 99.85
KOG0589 426 consensus Serine/threonine protein kinase [General 99.85
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.85
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.85
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.85
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.84
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.84
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.84
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.84
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.84
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.84
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.84
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.84
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.84
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.84
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.84
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.84
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.84
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.84
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.84
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.84
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.84
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.84
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.84
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.84
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.84
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.84
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.84
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.84
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.84
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.84
PHA03209 357 serine/threonine kinase US3; Provisional 99.84
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.84
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.84
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.84
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.84
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.84
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.84
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.84
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.84
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.84
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.84
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.84
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.84
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.84
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.84
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.83
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.83
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.83
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.83
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.83
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.83
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.83
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.83
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.83
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.83
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.83
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.83
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.83
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.83
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.83
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.83
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.83
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.83
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.83
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.83
KOG0586 596 consensus Serine/threonine protein kinase [General 99.83
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.83
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.83
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.83
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.83
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.83
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.83
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.83
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.83
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.83
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.83
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.83
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.83
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.83
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.83
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.83
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.83
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.82
PTZ00036 440 glycogen synthase kinase; Provisional 99.82
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.82
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.82
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.82
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.82
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.82
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.82
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.82
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.82
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.82
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.82
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.82
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.82
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.82
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.82
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.82
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.82
PTZ00283 496 serine/threonine protein kinase; Provisional 99.82
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.82
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.82
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.82
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.82
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.82
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.82
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.82
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.82
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 99.82
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.82
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.82
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.82
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.82
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.82
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.82
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.82
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.82
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.82
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.82
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.82
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.81
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.81
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.81
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.81
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.81
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.81
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.81
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.81
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.81
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.81
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.81
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.81
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.81
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.81
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.81
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.81
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.81
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.81
PHA03210 501 serine/threonine kinase US3; Provisional 99.81
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.81
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.81
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.81
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.81
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.81
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.81
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.81
KOG3653 534 consensus Transforming growth factor beta/activin 99.81
PHA03207 392 serine/threonine kinase US3; Provisional 99.81
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.8
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.8
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.8
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.8
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.8
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.8
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.8
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.8
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.8
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.8
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.8
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.8
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.8
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.8
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.8
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.8
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.8
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.8
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.8
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.8
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.79
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.79
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.79
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.79
PLN00009 294 cyclin-dependent kinase A; Provisional 99.79
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.79
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.79
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.79
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.79
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.79
cd05074 273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.79
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.79
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.79
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.79
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.79
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.79
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.78
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.78
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.78
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.78
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.78
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.78
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.78
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.78
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.78
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.78
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.78
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.78
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.78
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.78
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.78
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.78
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.77
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.77
PRK09188 365 serine/threonine protein kinase; Provisional 99.77
PRK10345210 hypothetical protein; Provisional 99.77
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.77
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.77
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.77
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.77
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.77
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.77
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.77
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.77
cd08222 260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.77
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.76
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.76
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.76
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.76
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.76
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.76
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.76
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.76
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.76
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.76
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.76
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.75
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.75
KOG1152772 consensus Signal transduction serine/threonine kin 99.75
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.75
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.75
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.75
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.75
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 99.75
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.75
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.74
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.74
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 99.74
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.73
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.73
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.73
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.73
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.73
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.73
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.72
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.72
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.72
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.71
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.7
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 99.7
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.7
PHA02882 294 putative serine/threonine kinase; Provisional 99.68
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 99.68
KOG0984 282 consensus Mitogen-activated protein kinase (MAPK) 99.68
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 99.68
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.67
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.67
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.67
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.66
KOG0596 677 consensus Dual specificity; serine/threonine and t 99.66
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.66
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.66
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.65
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.63
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.63
PRK14879211 serine/threonine protein kinase; Provisional 99.63
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.61
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.6
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 99.6
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.59
smart00090237 RIO RIO-like kinase. 99.59
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.59
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 99.59
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.57
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.57
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.56
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 99.55
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.54
PRK12274218 serine/threonine protein kinase; Provisional 99.54
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.5
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.47
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.45
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 99.43
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.4
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.39
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.38
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.36
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 99.32
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.07
PLN00181 793 protein SPA1-RELATED; Provisional 99.01
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.0
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 98.99
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 98.97
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.93
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.83
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 98.82
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.75
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 98.65
KOG3087229 consensus Serine/threonine protein kinase [General 98.64
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.63
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.46
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.37
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.35
PF14531 288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.33
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.21
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.14
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.09
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.07
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 97.95
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 97.92
KOG1243 690 consensus Protein kinase [General function predict 97.9
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 97.79
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.73
PRK09902216 hypothetical protein; Provisional 97.69
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.68
KOG1033 516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 97.59
COG0478304 RIO-like serine/threonine protein kinase fused to 97.56
KOG0606 1205 consensus Microtubule-associated serine/threonine 97.51
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.23
KOG1235 538 consensus Predicted unusual protein kinase [Genera 97.15
COG0661 517 AarF Predicted unusual protein kinase [General fun 97.07
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.04
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.04
PRK10593 297 hypothetical protein; Provisional 96.98
PLN02876 822 acyl-CoA dehydrogenase 96.93
PF01636 239 APH: Phosphotransferase enzyme family This family 96.77
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 96.58
COG1718268 RIO1 Serine/threonine protein kinase involved in c 96.26
cd05150 244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 95.75
KOG0606 1205 consensus Microtubule-associated serine/threonine 95.74
cd05155 235 APH_ChoK_like_1 Uncharacterized bacterial proteins 95.7
TIGR02721 256 ycfN_thiK thiamine kinase. Members of this family 94.55
KOG0576 829 consensus Mitogen-activated protein kinase kinase 94.33
PRK05231 319 homoserine kinase; Provisional 94.29
cd05157 235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 93.06
PRK09550 401 mtnK methylthioribose kinase; Reviewed 92.7
KOG1033 516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 91.63
TIGR00938 307 thrB_alt homoserine kinase, Neisseria type. Homose 91.1
KOG2270 520 consensus Serine/threonine protein kinase involved 90.95
PLN02756 418 S-methyl-5-thioribose kinase 89.89
PF03881 288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 87.81
cd05153 296 HomoserineK_II Homoserine Kinase, type II. Homoser 86.48
cd05156 302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 85.45
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 84.03
TIGR02906 313 spore_CotS spore coat protein, CotS family. Member 83.1
PRK12396 409 5-methylribose kinase; Reviewed 82.29
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 81.8
COG3173 321 Predicted aminoglycoside phosphotransferase [Gener 81.34
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 80.85
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=1.9e-33  Score=261.37  Aligned_cols=147  Identities=39%  Similarity=0.659  Sum_probs=133.1

Q ss_pred             CccccCHHHHHHHhCCCCCcceeeecCceEEEEEEECCCCceeEEEEEeeeecCCCchh-hHhHHHHHHHHHhCCCCCcc
Q 021169          161 TLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQG-VKEFINDVNTLASLQHPNLC  239 (316)
Q Consensus       161 ~~~~~~~~ei~~~t~~f~~~~~iG~G~fg~Vy~~~~~~~~~~~~~~~vavK~~~~~~~~-~~~~~~E~~~l~~l~HpnIv  239 (316)
                      ..+.|+++|+..+|++|...++||+|+||.||+|.+.++..      ||||++...... ..+|.+|+.+|.+++|+|||
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~------vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv  134 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTV------VAVKRLSSNSGQGEREFLNEVEILSRLRHPNLV  134 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCE------EEEEEecCCCCcchhHHHHHHHHHhcCCCcCcc
Confidence            56789999999999999999999999999999999999743      899988754443 66799999999999999999


Q ss_pred             eeeeEEEcCCCC-eEEEEEecCCCCCHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEeccCCCCCC
Q 021169          240 KLLGFHARDGSD-QRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE  316 (316)
Q Consensus       240 ~l~g~~~~~~~~-~~~lV~Ey~~~GsL~~~l~~~~~~~~l~~~~~~~ia~qia~gL~yLH~~~~~~IiHrDlKp~NI~  316 (316)
                      +|+|||.+.  + ..+||||||++|+|.++|+..... .++|..|++||.++|+||+|||+....+|||||||++||+
T Consensus       135 ~LlGyC~e~--~~~~~LVYEym~nGsL~d~L~~~~~~-~L~W~~R~kIa~g~A~gL~yLH~~~~~~iiHrDiKssNIL  209 (361)
T KOG1187|consen  135 KLLGYCLEG--GEHRLLVYEYMPNGSLEDHLHGKKGE-PLDWETRLKIALGAARGLAYLHEGCPPPIIHRDIKSSNIL  209 (361)
T ss_pred             cEEEEEecC--CceEEEEEEccCCCCHHHHhCCCCCC-CCCHHHHHHHHHHHHHHHHHHccCCCCCEecCCCCHHHee
Confidence            999999985  5 599999999999999999987533 7899999999999999999999987668999999999995



>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 4e-11
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 4e-11
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-11
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 2e-10
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 2e-10
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 4e-10
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 9e-09
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-08
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 1e-04
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-04
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 51/134 (38%), Positives = 72/134 (53%), Gaps = 17/134 (12%) Query: 176 NFFSDRCIS-------EGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKE-FINDV 227 N F +R IS EG V+Y+ + KK A V + +++ +K+ F ++ Sbjct: 25 NNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMV---DITTEELKQQFDQEI 81 Query: 228 NTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSL-DRLIYGRSDG-PPIDWNTRVK 285 +A QH NL +LLGF + DG D L+Y + +GSL DRL DG PP+ W+ R K Sbjct: 82 KVMAKCQHENLVELLGF-SSDGDD-LCLVYVYMPNGSLLDRL--SCLDGTPPLSWHMRCK 137 Query: 286 IALCAAQGLTFLHE 299 IA AA G+ FLHE Sbjct: 138 IAQGAANGINFLHE 151
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-33
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 5e-33
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 2e-30
3soc_A 322 Activin receptor type-2A; structural genomics cons 2e-19
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-15
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 8e-15
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-14
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 4e-14
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 9e-14
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 2e-13
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-12
3q4u_A 301 Activin receptor type-1; structural genomics conso 1e-11
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 2e-11
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 5e-11
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 9e-11
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 1e-10
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 1e-10
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 3e-10
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-08
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 7e-08
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-07
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-07
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 4e-07
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 7e-06
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 9e-06
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 9e-06
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 1e-05
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-05
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 1e-05
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-05
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-05
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-05
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 4e-05
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-05
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 6e-05
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 7e-05
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 8e-05
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 8e-05
3pls_A 298 Macrophage-stimulating protein receptor; protein k 9e-05
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-04
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-04
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-04
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-04
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-04
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-04
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 3e-04
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-04
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 5e-04
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 5e-04
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 6e-04
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 8e-04
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 9e-04
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
 Score =  124 bits (314), Expect = 1e-33
 Identities = 41/161 (25%), Positives = 64/161 (39%), Gaps = 25/161 (15%)

Query: 159 TGTLRNFPLDEVAAACHNFFSDRCISEGLSSVMYRASFG-------DDASTSKKFEATVT 211
                +F   E+    +NF  D        + M    FG       ++          V 
Sbjct: 9   DTRFHSFSFYELKNVTNNF--DERPISVGGNKMGEGGFGVVYKGYVNNT------TVAVK 60

Query: 212 RLNP-----SSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQRMLIYERLFHGSLD 266
           +L       + +  ++F  ++  +A  QH NL +LLGF +    D   L+Y  + +GSL 
Sbjct: 61  KLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDG--DDLCLVYVYMPNGSLL 118

Query: 267 RLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIF 307
             +      PP+ W+ R KIA  AA G+ FLHE      I 
Sbjct: 119 DRLSCLDGTPPLSWHMRCKIAQGAANGINFLHEN---HHIH 156


>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.97
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.97
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.97
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.97
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.97
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.96
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.96
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.96
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.96
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.96
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.96
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.96
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.96
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.96
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.95
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.94
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.94
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.94
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.93
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.92
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.91
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.91
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.91
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.91
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.91
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.91
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.91
3uqc_A 286 Probable conserved transmembrane protein; structur 99.91
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.91
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.91
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.91
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.91
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.91
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.91
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.91
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.91
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.9
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.9
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.9
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.9
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.9
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.9
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.9
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.9
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.9
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.9
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.9
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.9
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.9
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.9
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.9
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.9
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.9
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.9
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.9
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.9
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.9
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.9
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.9
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.9
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.9
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.9
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.9
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.9
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.9
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.89
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.89
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.89
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.89
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.89
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.89
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.89
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.89
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.89
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.89
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.89
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.89
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.89
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.89
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.89
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.89
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.89
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.89
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.89
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.89
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.89
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.89
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.89
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.89
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.89
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.89
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.89
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.89
3niz_A 311 Rhodanese family protein; structural genomics, str 99.89
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.89
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.89
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.89
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.89
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.89
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.89
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.89
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.88
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.88
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.88
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.88
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.88
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.88
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.88
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.88
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.88
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.88
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.88
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.88
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.88
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.88
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.88
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.88
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.88
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.88
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.88
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.88
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.88
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.88
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.88
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.88
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.88
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.88
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.88
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.88
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.88
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.88
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.88
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.88
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.88
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.88
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.88
3bhy_A 283 Death-associated protein kinase 3; death associate 99.88
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.88
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.88
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.88
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.88
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.88
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.88
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.88
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.88
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.88
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.88
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.88
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.88
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.87
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.87
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.87
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.87
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.87
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.87
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.87
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.87
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.87
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.87
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.87
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.87
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.87
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.87
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.87
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.87
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.87
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.87
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.87
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.87
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.87
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.87
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.87
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.87
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.87
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.87
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.87
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.87
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.87
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.87
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.87
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.87
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.87
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.87
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.87
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.87
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.87
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.87
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.86
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.86
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.86
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.86
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.86
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.86
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.86
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.86
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.86
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.86
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.86
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.86
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.86
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.86
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.86
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.86
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.86
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.86
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.86
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.86
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.86
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.86
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.86
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.86
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.86
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.85
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.85
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.85
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.85
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.85
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.85
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.85
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.85
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.85
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.85
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.85
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.85
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.85
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.85
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.85
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.85
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.85
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.84
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.84
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.84
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.84
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.84
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.84
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.84
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.84
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.84
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.84
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.84
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.83
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.83
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.83
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.83
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.83
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.82
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.81
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.81
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.8
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.8
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.79
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.77
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.71
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.67
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.53
3tm0_A 263 Aminoglycoside 3'-phosphotransferase; protein kina 99.05
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 98.79
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 98.77
3r70_A 320 Aminoglycoside phosphotransferase; structural geno 98.17
3sg8_A 304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.99
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 97.89
4gkh_A 272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 97.67
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.52
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 97.47
3ats_A 357 Putative uncharacterized protein; hypothetical pro 97.04
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.58
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 96.45
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.84
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 95.28
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 94.56
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 87.94
1zyl_A 328 Hypothetical protein YIHE; putative protein kinase 86.23
2ppq_A 322 HSK, HK, homoserine kinase; structural genomics, M 85.68
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 83.93
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 82.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 82.21
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 81.25
3csv_A 333 Aminoglycoside phosphotransferase; YP_614837.1, ph 81.15
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 81.13
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 80.86
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
Probab=99.97  E-value=3.1e-31  Score=240.19  Aligned_cols=137  Identities=20%  Similarity=0.344  Sum_probs=112.5

Q ss_pred             CCCCCcceeeecCceEEEEEEECCCCceeEEEEEeeeecCC-CchhhHhHHHHHHHHHhCCCCCcceeeeEEEcCCCCeE
Q 021169          175 HNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNP-SSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQR  253 (316)
Q Consensus       175 ~~f~~~~~iG~G~fg~Vy~~~~~~~~~~~~~~~vavK~~~~-~~~~~~~~~~E~~~l~~l~HpnIv~l~g~~~~~~~~~~  253 (316)
                      ++|...+.||+|+||.||+|++.+.........||||.++. .....++|.+|+.+|++++|||||+++|+|.+.  +.+
T Consensus        13 ~~~~l~~~lG~G~fG~Vy~a~~~~~~~~~~~~~vAvK~l~~~~~~~~~~f~~E~~il~~l~HpnIV~l~g~~~~~--~~~   90 (299)
T 4asz_A           13 HNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEG--DPL   90 (299)
T ss_dssp             GGEEEEEEEEC--CCCEEEEEECSCC----CEEEEEEEECSCCHHHHHHHHHHHHHHTTCCCTTBCCEEEEECSS--SSE
T ss_pred             HHeEEeeEEeeCCCcEEEEEEECCcccCCCCEEEEEEEeCCCChHHHHHHHHHHHHHHhCCCCCCccEEEEEeeC--CEE
Confidence            45677799999999999999986532211123489999874 345567899999999999999999999999884  789


Q ss_pred             EEEEecCCCCCHHHHHhcCC----------CCCCCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEeccCCCCCC
Q 021169          254 MLIYERLFHGSLDRLIYGRS----------DGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE  316 (316)
Q Consensus       254 ~lV~Ey~~~GsL~~~l~~~~----------~~~~l~~~~~~~ia~qia~gL~yLH~~~~~~IiHrDlKp~NI~  316 (316)
                      |||||||++|+|.++|+...          ....++|..++.|+.||+.||.|||++   +||||||||+||+
T Consensus        91 ~lV~Ey~~~G~L~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qia~gl~yLH~~---~iiHRDlKp~NIL  160 (299)
T 4asz_A           91 IMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQ---HFVHRDLATRNCL  160 (299)
T ss_dssp             EEEEECCTTCBHHHHHHHTSHHHHHC----CCCCCCHHHHHHHHHHHHHHHHHHHHT---TCCCSCCSGGGEE
T ss_pred             EEEEEcCCCCcHHHHHHhcCcccccccccCCCCCCCHHHHHHHHHHHHHHHHHHHhC---CcccCccCHhhEE
Confidence            99999999999999997642          134699999999999999999999994   7999999999984



>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-15
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 7e-15
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-14
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-14
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-14
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 5e-14
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 8e-14
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-13
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-13
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 1e-13
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 2e-13
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 5e-13
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 6e-13
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 8e-13
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 1e-12
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-12
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-12
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-11
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-11
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-11
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-11
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-11
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 8e-11
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-10
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-10
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-10
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-10
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-10
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-10
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-09
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-09
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-09
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 4e-09
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-09
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 9e-09
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-08
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 6e-08
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-08
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-07
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-07
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-07
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 4e-07
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 4e-07
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 5e-07
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-06
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-06
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-06
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-06
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-05
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-05
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 5e-05
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-04
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-04
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-04
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-04
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.1 bits (179), Expect = 1e-15
 Identities = 24/121 (19%), Positives = 44/121 (36%), Gaps = 10/121 (8%)

Query: 181 RCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCK 240
             +  G    ++   +          +  V  L   S     F+ + N +  LQH  L +
Sbjct: 19  ERLGAGQFGEVWMGYYNGHT------KVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVR 72

Query: 241 LLGFHARDGSDQRMLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEE 300
           L         +   +I E + +GSL   +   S G  +  N  + +A   A+G+ F+ E 
Sbjct: 73  LYAVVT---QEPIYIITEYMENGSLVDFLKTPS-GIKLTINKLLDMAAQIAEGMAFIEER 128

Query: 301 G 301
            
Sbjct: 129 N 129


>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.96
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.96
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.96
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.96
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.96
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.96
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.96
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.95
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.95
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.95
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.95
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.95
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.95
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.95
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.95
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.95
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.95
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.95
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.95
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.95
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.95
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.95
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.95
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.95
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.94
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.94
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.94
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.94
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.94
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.94
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.94
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.94
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.94
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.93
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.93
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.93
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.93
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.93
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.93
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.93
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.93
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.93
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.93
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.93
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.93
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.92
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.92
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.92
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.92
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.92
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.91
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.91
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.9
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.9
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.9
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.9
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.89
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.89
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.83
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.76
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.82
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 96.57
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 94.92
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 90.23
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 89.37
d2ppqa1 316 Homoserine kinase ThrB {Agrobacterium tumefaciens 85.57
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96  E-value=6.7e-31  Score=234.71  Aligned_cols=132  Identities=17%  Similarity=0.257  Sum_probs=117.7

Q ss_pred             hCCCCCcceeeecCceEEEEEEECCCCceeEEEEEeeeecCCCchhhHhHHHHHHHHHhCCCCCcceeeeEEEcCCCCeE
Q 021169          174 CHNFFSDRCISEGLSSVMYRASFGDDASTSKKFEATVTRLNPSSQGVKEFINDVNTLASLQHPNLCKLLGFHARDGSDQR  253 (316)
Q Consensus       174 t~~f~~~~~iG~G~fg~Vy~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~E~~~l~~l~HpnIv~l~g~~~~~~~~~~  253 (316)
                      .++|...+.||+|+||.||+|.+..++.     .||||.+..+....++|.+|+.+|++++|||||+++|+|.++  +.+
T Consensus        16 ~~~~~~~~~iG~G~fg~Vy~a~~~~~~~-----~vAvK~i~~~~~~~~~~~~E~~il~~l~HpnIv~~~~~~~~~--~~~   88 (287)
T d1opja_          16 RTDITMKHKLGGGQYGEVYEGVWKKYSL-----TVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTRE--PPF   88 (287)
T ss_dssp             GGGEEEEEETTTTTTSSEEEEEEGGGTE-----EEEEEECCTTCSCHHHHHHHHHHHHHCCCTTBCCEEEEECSS--SSC
T ss_pred             HHHeEEeeEEeeCCCeEEEEEEECCCCe-----EEEEEEECCccchHHHHHHHHHHHHhCCCCCEecCCccEeeC--Cee
Confidence            4567778999999999999999987664     389999987666778899999999999999999999999874  889


Q ss_pred             EEEEecCCCCCHHHHHhcCCCCCCCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEeccCCCCCC
Q 021169          254 MLIYERLFHGSLDRLIYGRSDGPPIDWNTRVKIALCAAQGLTFLHEEGPFQVIFYYFEMIKTE  316 (316)
Q Consensus       254 ~lV~Ey~~~GsL~~~l~~~~~~~~l~~~~~~~ia~qia~gL~yLH~~~~~~IiHrDlKp~NI~  316 (316)
                      +||||||++|+|.++|.... ...+++..++.|+.||+.||.|||++   +||||||||+||+
T Consensus        89 ~iv~E~~~~g~l~~~l~~~~-~~~~~~~~~~~i~~qi~~gL~yLH~~---~iiHrDlKp~NIL  147 (287)
T d1opja_          89 YIITEFMTYGNLLDYLRECN-RQEVSAVVLLYMATQISSAMEYLEKK---NFIHRDLAARNCL  147 (287)
T ss_dssp             EEEEECCTTCBHHHHHHHSC-TTTSCHHHHHHHHHHHHHHHHHHHHT---TCCCSCCSGGGEE
T ss_pred             EEEeecccCcchHHHhhhcc-ccchHHHHHHHHHHHHHHHHHHHHHC---CcccCccccCeEE
Confidence            99999999999999998654 34699999999999999999999995   6999999999984



>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure