Query         021187
Match_columns 316
No_of_seqs    254 out of 1002
Neff          5.5 
Searched_HMMs 46136
Date          Fri Mar 29 08:17:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/021187.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/021187hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 5.5E-44 1.2E-48  300.7   8.0  127    9-138     1-129 (129)
  2 PHA00692 hypothetical protein   31.0      20 0.00044   26.9   0.5   10    8-17     36-45  (74)
  3 smart00265 BH4 BH4 Bcl-2 homol  25.7      83  0.0018   20.0   2.5   20   18-37      4-23  (27)
  4 PF04700 Baculo_gp41:  Structur  22.1      80  0.0017   28.8   2.7   20   18-37      6-27  (186)
  5 KOG3238 Chloride ion current i  20.2 1.3E+02  0.0029   27.9   3.7   62    9-71    109-170 (216)
  6 PF01473 CW_binding_1:  Putativ  15.6 1.1E+02  0.0023   17.2   1.3    8   65-72      7-14  (19)
  7 PF14599 zinc_ribbon_6:  Zinc-r  15.2      53  0.0012   24.7   0.0   19  273-291     5-23  (61)
  8 PF02180 BH4:  Bcl-2 homology r  14.1 2.1E+02  0.0046   18.2   2.5   19   19-37      5-23  (27)
  9 smart00707 RPEL Repeat in Dros  13.8 1.2E+02  0.0026   19.1   1.3   14   12-25      6-19  (26)
 10 PLN02417 dihydrodipicolinate s  13.3 1.3E+02  0.0027   28.5   2.0   17    9-26    103-119 (280)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=5.5e-44  Score=300.72  Aligned_cols=127  Identities=54%  Similarity=1.126  Sum_probs=97.0

Q ss_pred             CCCCceeCCChHHHHHHHHHHHHhcCCCCC-CceecccCCCCCCchhhhhhhcCcccCCeEEEEeccCCCCCCCCccccc
Q 021187            9 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQERCRIGYEEQNEWYFFSHKDKKYPTGTRTNRA   87 (316)
Q Consensus         9 LPpGfRF~PTDeELV~~YL~~Ki~g~~l~~-~~I~dvDvy~~ePwdL~~~~~~g~~~~~ewYFFs~r~~k~~tG~R~nRa   87 (316)
                      |||||||+|||+|||.+||++|+.+.+++. ++|.++|||.+|||+|+....   ..+++||||+++.+++++|.|++|+
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~~---~~~~~~yFF~~~~~~~~~~~r~~R~   77 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKFK---GGDEEWYFFSPRKKKYPNGGRPNRV   77 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHSS---S-SSEEEEEEE----------S-EE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhcc---CCCceEEEEEecccccCCccccccc
Confidence            899999999999999999999999999887 799999999999999995322   2457999999999999999999999


Q ss_pred             ccCceeeecCCCeeeec-CCeeEEEEEEEEEeecCCCCCCCcCeEEEEEEeC
Q 021187           88 TMAGFWKATGRDKAVYD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE  138 (316)
Q Consensus        88 t~~G~Wk~tG~~k~I~~-~g~~IG~KKtLvFy~gr~p~g~KT~WvMhEY~L~  138 (316)
                      +++|+||++|+.++|.. ++.+||+||+|+||.++.+++.||+|+||||+|+
T Consensus        78 ~~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   78 TGGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             ETTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             ccceEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            99999999999999998 8999999999999999888999999999999984


No 2  
>PHA00692 hypothetical protein
Probab=31.00  E-value=20  Score=26.94  Aligned_cols=10  Identities=60%  Similarity=1.122  Sum_probs=7.7

Q ss_pred             CCCCCceeCC
Q 021187            8 YVPPGFRFHP   17 (316)
Q Consensus         8 ~LPpGfRF~P   17 (316)
                      ..||||||--
T Consensus        36 eyppgfrfgg   45 (74)
T PHA00692         36 EYPPGFRFGG   45 (74)
T ss_pred             ecCCCccccc
Confidence            3799999953


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=25.67  E-value=83  Score=20.02  Aligned_cols=20  Identities=25%  Similarity=0.380  Sum_probs=15.6

Q ss_pred             ChHHHHHHHHHHHHhcCCCC
Q 021187           18 TDEELVGYYLRKKVASQKID   37 (316)
Q Consensus        18 TDeELV~~YL~~Ki~g~~l~   37 (316)
                      +-.|||.+|+.-|+.-...+
T Consensus         4 ~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCC
Confidence            45799999999998765443


No 4  
>PF04700 Baculo_gp41:  Structural glycoprotein p40/gp41 conserved region;  InterPro: IPR006790 This is a family of viral structural glycoproteins [] from the baculoviridae.; GO: 0005198 structural molecule activity, 0019012 virion
Probab=22.15  E-value=80  Score=28.83  Aligned_cols=20  Identities=45%  Similarity=0.816  Sum_probs=14.7

Q ss_pred             ChHHHHHHH--HHHHHhcCCCC
Q 021187           18 TDEELVGYY--LRKKVASQKID   37 (316)
Q Consensus        18 TDeELV~~Y--L~~Ki~g~~l~   37 (316)
                      +|||||.||  |.+|..|...+
T Consensus         6 sDe~Li~yY~~L~K~~g~~~~~   27 (186)
T PF04700_consen    6 SDEELIEYYANLEKKYGGSDVP   27 (186)
T ss_pred             cHHHHHHHHHHHHHHhCCCCCC
Confidence            799999999  66666655443


No 5  
>KOG3238 consensus Chloride ion current inducer protein [Inorganic ion transport and metabolism]
Probab=20.23  E-value=1.3e+02  Score=27.91  Aligned_cols=62  Identities=23%  Similarity=0.358  Sum_probs=36.3

Q ss_pred             CCCCceeCCChHHHHHHHHHHHHhcCCCCCCceecccCCCCCCchhhhhhhcCcccCCeEEEE
Q 021187            9 VPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQERCRIGYEEQNEWYFF   71 (316)
Q Consensus         9 LPpGfRF~PTDeELV~~YL~~Ki~g~~l~~~~I~dvDvy~~ePwdL~~~~~~g~~~~~ewYFF   71 (316)
                      .--+|||+|+|.--+.----...-.+.+.+....+.+-|.-+=|+.-.. ..|.+....||=+
T Consensus       109 ~i~e~rfvpsDk~~l~a~f~qfcecqel~p~P~ED~~~~dgee~~mea~-d~~~gDs~~~~t~  170 (216)
T KOG3238|consen  109 PITEFRFVPSDKSALEAMFTQFCECQELNPDPDEDEDDYDGEEYDMEAH-DAGQGDSPNSYTY  170 (216)
T ss_pred             ccccceecCCchhHHHHHHHHHHhhhhcCCCccccccccccchhhhhhh-hccCCCCcccccc
Confidence            3458999999987777633333344555444456677777777776544 2333333445444


No 6  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=15.58  E-value=1.1e+02  Score=17.17  Aligned_cols=8  Identities=38%  Similarity=1.522  Sum_probs=6.4

Q ss_pred             CCeEEEEe
Q 021187           65 QNEWYFFS   72 (316)
Q Consensus        65 ~~ewYFFs   72 (316)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            47899994


No 7  
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=15.16  E-value=53  Score=24.65  Aligned_cols=19  Identities=32%  Similarity=0.499  Sum_probs=0.0

Q ss_pred             CcChHHHHHHHHhhcCccc
Q 021187          273 VTDWRALDKFVASQLSQED  291 (316)
Q Consensus       273 ~~dw~~ld~~vasql~~~~  291 (316)
                      ..-||.||+-+|+|-=+++
T Consensus         5 ~~~w~~LD~~i~~~pmP~~   23 (61)
T PF14599_consen    5 SAYWRMLDAEIAATPMPEE   23 (61)
T ss_dssp             -------------------
T ss_pred             HHHHHHHHHHHHhCCCCHH
Confidence            3569999999999875544


No 8  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=14.09  E-value=2.1e+02  Score=18.22  Aligned_cols=19  Identities=26%  Similarity=0.377  Sum_probs=15.0

Q ss_pred             hHHHHHHHHHHHHhcCCCC
Q 021187           19 DEELVGYYLRKKVASQKID   37 (316)
Q Consensus        19 DeELV~~YL~~Ki~g~~l~   37 (316)
                      -.|||.+|+.-|+.-+..+
T Consensus         5 nR~lV~~yi~yKLsQrgy~   23 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRGYV   23 (27)
T ss_dssp             HHHHHHHHHHHHHHHTTST
T ss_pred             HHHHHHHHHHHHhhhcCCC
Confidence            4799999999998765544


No 9  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=13.80  E-value=1.2e+02  Score=19.10  Aligned_cols=14  Identities=36%  Similarity=0.363  Sum_probs=11.3

Q ss_pred             CceeCCChHHHHHH
Q 021187           12 GFRFHPTDEELVGY   25 (316)
Q Consensus        12 GfRF~PTDeELV~~   25 (316)
                      ...++|+.+|||.-
T Consensus         6 kl~~RP~~eeLv~r   19 (26)
T smart00707        6 KLSQRPTREELEER   19 (26)
T ss_pred             HHHcCCCHHHHHHc
Confidence            45689999999973


No 10 
>PLN02417 dihydrodipicolinate synthase
Probab=13.34  E-value=1.3e+02  Score=28.53  Aligned_cols=17  Identities=18%  Similarity=0.446  Sum_probs=14.2

Q ss_pred             CCCCceeCCChHHHHHHH
Q 021187            9 VPPGFRFHPTDEELVGYY   26 (316)
Q Consensus         9 LPpGfRF~PTDeELV~~Y   26 (316)
                      +|| +-|.||++||+.||
T Consensus       103 ~~P-~y~~~~~~~i~~~f  119 (280)
T PLN02417        103 INP-YYGKTSQEGLIKHF  119 (280)
T ss_pred             cCC-ccCCCCHHHHHHHH
Confidence            566 45899999999997


Done!