Citrus Sinensis ID: 021221


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MGLRFWETGILMLVLWGRLTCAVVAVRFPLCPTESVTDSIFRFQDSFCPISCNDFQDIVGVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIEESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTASLDKISPDKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIFAQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLATVSIGDASSSRGACVNECHFH
cccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEEccccHHHccccccHHHHHHHccccccEEEEccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccEEEcccccccccccccccccc
**LRFWETGILMLVLWGRLTCAVVAVRFPLCPTESVTDSIFRFQDSFCPISCNDFQDIVGVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIEESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTAS************************SCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIFAQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLA*********************
xxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLRFWETGILMLVLWGRLTCAVVAVRFPLCPTESVTDSIFRFQDSFCPISCNDFQDIVGVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIEESAIRPSILSKYGVHGFPTLFLLNSSMRVRYHGSRTLDSLVAFYSDVTASLDKISPDKVGKASNHEKHNNTEEESCPFSWARSPENLLQQETYLALATAFVLLRLVYIFLPTLLIFAQFTWRRLIRNLKLGSLLEHPRTYLNRAIQLFKTLNEPCKRSNLQEGALNARAWASKSLATVSIGDASSSRGACVNECHFH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5'-adenylylsulfate reductase-like 4 probableQ9SA00
5'-adenylylsulfate reductase-like 3 probableQ84P95

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 32-45,57-240
View the alignment between query and template
View the model in PyMOL
Template: 2HLS, chain A
Confidence level:confident
Coverage over the Query: 69-248,263-282
View the alignment between query and template
View the model in PyMOL