BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 021242
         (315 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1V04|A Chain A, Serum Paraoxonase By Directed Evolution
 pdb|3SRE|A Chain A, Serum Paraoxonase-1 By Directed Evolution At Ph 6.5
 pdb|3SRG|A Chain A, Serum Paraoxonase-1 By Directed Evolution At Ph 6.5 In
           Complex With 2- Hydroxyquinoline
          Length = 355

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 44  ISEAGSIPYLAEILYSSSHAFQENAAATLLNLSITSRDSLM 84
           IS  G   Y+AE+L    H ++++A  TL  L + S D+L+
Sbjct: 228 ISPDGKYVYIAELLAHKIHVYEKHANWTLTPLRVLSFDTLV 268


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.358 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,930,841
Number of Sequences: 62578
Number of extensions: 228937
Number of successful extensions: 743
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 742
Number of HSP's gapped (non-prelim): 3
length of query: 315
length of database: 14,973,337
effective HSP length: 99
effective length of query: 216
effective length of database: 8,778,115
effective search space: 1896072840
effective search space used: 1896072840
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)