BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 021242
(315 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1V04|A Chain A, Serum Paraoxonase By Directed Evolution
pdb|3SRE|A Chain A, Serum Paraoxonase-1 By Directed Evolution At Ph 6.5
pdb|3SRG|A Chain A, Serum Paraoxonase-1 By Directed Evolution At Ph 6.5 In
Complex With 2- Hydroxyquinoline
Length = 355
Score = 30.0 bits (66), Expect = 1.9, Method: Compositional matrix adjust.
Identities = 15/41 (36%), Positives = 24/41 (58%)
Query: 44 ISEAGSIPYLAEILYSSSHAFQENAAATLLNLSITSRDSLM 84
IS G Y+AE+L H ++++A TL L + S D+L+
Sbjct: 228 ISPDGKYVYIAELLAHKIHVYEKHANWTLTPLRVLSFDTLV 268
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.358
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,930,841
Number of Sequences: 62578
Number of extensions: 228937
Number of successful extensions: 743
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 742
Number of HSP's gapped (non-prelim): 3
length of query: 315
length of database: 14,973,337
effective HSP length: 99
effective length of query: 216
effective length of database: 8,778,115
effective search space: 1896072840
effective search space used: 1896072840
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)